BLASTX nr result
ID: Atractylodes21_contig00048154
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00048154 (329 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278335.2| PREDICTED: histone-lysine N-methyltransferas... 56 3e-06 emb|CBI40526.3| unnamed protein product [Vitis vinifera] 56 3e-06 >ref|XP_002278335.2| PREDICTED: histone-lysine N-methyltransferase ATX4-like [Vitis vinifera] Length = 1073 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -2 Query: 325 VHVICARFRPEVAFLGDEKVEPATGLLRIPPDSWIGV 215 VHV CA FRPEVAFL DEK+EPA G+LRIP S++ V Sbjct: 715 VHVTCAWFRPEVAFLNDEKMEPAVGILRIPSTSFLKV 751 >emb|CBI40526.3| unnamed protein product [Vitis vinifera] Length = 1003 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -2 Query: 325 VHVICARFRPEVAFLGDEKVEPATGLLRIPPDSWIGV 215 VHV CA FRPEVAFL DEK+EPA G+LRIP S++ V Sbjct: 645 VHVTCAWFRPEVAFLNDEKMEPAVGILRIPSTSFLKV 681