BLASTX nr result
ID: Atractylodes21_contig00048151
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00048151 (370 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADD16956.1| C4C4-type RING finger protein [Vitis pseudoreticu... 68 9e-10 emb|CBI15100.3| unnamed protein product [Vitis vinifera] 68 9e-10 ref|XP_002283833.1| PREDICTED: uncharacterized protein LOC100248... 68 9e-10 gb|ACJ06699.1| putative anti-virus transcriptional factor [Vitis... 68 9e-10 gb|ACJ06697.1| putative anti-virus transcriptional factor [Vitis... 68 9e-10 >gb|ADD16956.1| C4C4-type RING finger protein [Vitis pseudoreticulata] Length = 350 Score = 67.8 bits (164), Expect = 9e-10 Identities = 32/52 (61%), Positives = 37/52 (71%), Gaps = 8/52 (15%) Frame = -2 Query: 369 LCLFCHKRILEDDGRCPGCRKPYDHHA--------QGNASSKLGRSYSMMPR 238 LCLFCHKRILE+DGRCPGCRKPYD G+ + +LGRSYSM+ R Sbjct: 298 LCLFCHKRILEEDGRCPGCRKPYDCDPVGAEAIVNGGSLTFRLGRSYSMIAR 349 >emb|CBI15100.3| unnamed protein product [Vitis vinifera] Length = 306 Score = 67.8 bits (164), Expect = 9e-10 Identities = 32/52 (61%), Positives = 37/52 (71%), Gaps = 8/52 (15%) Frame = -2 Query: 369 LCLFCHKRILEDDGRCPGCRKPYDHHA--------QGNASSKLGRSYSMMPR 238 LCLFCHKRILE+DGRCPGCRKPYD G+ + +LGRSYSM+ R Sbjct: 254 LCLFCHKRILEEDGRCPGCRKPYDCDPVEAEAIVNGGSLTFRLGRSYSMIAR 305 >ref|XP_002283833.1| PREDICTED: uncharacterized protein LOC100248510 [Vitis vinifera] Length = 348 Score = 67.8 bits (164), Expect = 9e-10 Identities = 32/52 (61%), Positives = 37/52 (71%), Gaps = 8/52 (15%) Frame = -2 Query: 369 LCLFCHKRILEDDGRCPGCRKPYDHHA--------QGNASSKLGRSYSMMPR 238 LCLFCHKRILE+DGRCPGCRKPYD G+ + +LGRSYSM+ R Sbjct: 296 LCLFCHKRILEEDGRCPGCRKPYDCDPVEAEAIVNGGSLTFRLGRSYSMIAR 347 >gb|ACJ06699.1| putative anti-virus transcriptional factor [Vitis pseudoreticulata] Length = 348 Score = 67.8 bits (164), Expect = 9e-10 Identities = 32/52 (61%), Positives = 37/52 (71%), Gaps = 8/52 (15%) Frame = -2 Query: 369 LCLFCHKRILEDDGRCPGCRKPYDHHA--------QGNASSKLGRSYSMMPR 238 LCLFCHKRILE+DGRCPGCRKPYD G+ + +LGRSYSM+ R Sbjct: 296 LCLFCHKRILEEDGRCPGCRKPYDCDPVEAEAIVNGGSLTFRLGRSYSMIAR 347 >gb|ACJ06697.1| putative anti-virus transcriptional factor [Vitis pseudoreticulata] Length = 350 Score = 67.8 bits (164), Expect = 9e-10 Identities = 32/52 (61%), Positives = 37/52 (71%), Gaps = 8/52 (15%) Frame = -2 Query: 369 LCLFCHKRILEDDGRCPGCRKPYDHHA--------QGNASSKLGRSYSMMPR 238 LCLFCHKRILE+DGRCPGCRKPYD G+ + +LGRSYSM+ R Sbjct: 298 LCLFCHKRILEEDGRCPGCRKPYDCDPVGAEAIVNGGSLTFRLGRSYSMIAR 349