BLASTX nr result
ID: Atractylodes21_contig00048140
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00048140 (242 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003540102.1| PREDICTED: probable WRKY transcription facto... 56 3e-06 >ref|XP_003540102.1| PREDICTED: probable WRKY transcription factor 32 [Glycine max] Length = 467 Score = 56.2 bits (134), Expect = 3e-06 Identities = 37/86 (43%), Positives = 42/86 (48%), Gaps = 33/86 (38%) Frame = +3 Query: 3 VHDHDMPVPKKRHPPPTHLIIT-------NNI-------LQSNATEA------------- 101 VHDHDMPVPKKRH PP+ ++ NN+ LQS TEA Sbjct: 382 VHDHDMPVPKKRHGPPSASLVAAAAPASMNNVQFKKTGLLQSQETEAQCSEDTEGELMGE 441 Query: 102 ------AKTCESAPTLLSVGFEIKHC 161 K ESA TLLS+GFEIK C Sbjct: 442 AMDLEGEKAIESARTLLSIGFEIKPC 467