BLASTX nr result
ID: Atractylodes21_contig00047451
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00047451 (680 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002318750.1| predicted protein [Populus trichocarpa] gi|2... 54 2e-07 >ref|XP_002318750.1| predicted protein [Populus trichocarpa] gi|222859423|gb|EEE96970.1| predicted protein [Populus trichocarpa] Length = 59 Score = 53.9 bits (128), Expect(3) = 2e-07 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -3 Query: 177 IFVCYTIQFSTTN*FNSSDIVIHDIDPIQDHR*VMHSL 64 IF+CYTIQFST N F SSDIVIHDID I+ HR +H + Sbjct: 2 IFLCYTIQFSTINRFESSDIVIHDIDLIRYHRDGIHPI 39 Score = 23.9 bits (50), Expect(3) = 2e-07 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -2 Query: 67 IELTGERFIISMGLNPELL 11 IE GERF+IS G+ ++ Sbjct: 39 IEFRGERFLISYGIKSRII 57 Score = 22.7 bits (47), Expect(3) = 2e-07 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = -1 Query: 35 YGIKSRVIVK 6 YGIKSR+IVK Sbjct: 50 YGIKSRIIVK 59