BLASTX nr result
ID: Atractylodes21_contig00047298
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00047298 (294 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_190170.2| Cysteine/Histidine-rich C1 domain family protei... 66 3e-09 emb|CAB82808.1| putative protein [Arabidopsis thaliana] 66 3e-09 dbj|BAC41953.1| unknown protein [Arabidopsis thaliana] gi|290290... 61 8e-08 ref|NP_680208.1| cysteine/histidine-rich C1 domain-containing pr... 61 8e-08 gb|ABD65623.1| DC1 domain-containing protein [Brassica oleracea] 60 1e-07 >ref|NP_190170.2| Cysteine/Histidine-rich C1 domain family protein [Arabidopsis thaliana] gi|332644558|gb|AEE78079.1| Cysteine/Histidine-rich C1 domain family protein [Arabidopsis thaliana] Length = 591 Score = 65.9 bits (159), Expect = 3e-09 Identities = 27/62 (43%), Positives = 38/62 (61%) Frame = -3 Query: 280 CALFLSRTTRHKLDKHTMNLKYLPVENHKSQYFCEVCEEELDPNGWFYHCDVCVQSMHTS 101 C L +T +HK D+H ++L Y E +Y C++CE E+DP+ WFY CD CV + H Sbjct: 462 CCANLPKTLKHKYDRHPLSLCY--GEKASGKYCCDICETEMDPSKWFYTCDDCVVTFHID 519 Query: 100 CV 95 CV Sbjct: 520 CV 521 >emb|CAB82808.1| putative protein [Arabidopsis thaliana] Length = 633 Score = 65.9 bits (159), Expect = 3e-09 Identities = 27/62 (43%), Positives = 38/62 (61%) Frame = -3 Query: 280 CALFLSRTTRHKLDKHTMNLKYLPVENHKSQYFCEVCEEELDPNGWFYHCDVCVQSMHTS 101 C L +T +HK D+H ++L Y E +Y C++CE E+DP+ WFY CD CV + H Sbjct: 462 CCANLPKTLKHKYDRHPLSLCY--GEKASGKYCCDICETEMDPSKWFYTCDDCVVTFHID 519 Query: 100 CV 95 CV Sbjct: 520 CV 521 >dbj|BAC41953.1| unknown protein [Arabidopsis thaliana] gi|29029012|gb|AAO64885.1| At5g22355 [Arabidopsis thaliana] Length = 664 Score = 61.2 bits (147), Expect = 8e-08 Identities = 25/58 (43%), Positives = 35/58 (60%) Frame = -3 Query: 268 LSRTTRHKLDKHTMNLKYLPVENHKSQYFCEVCEEELDPNGWFYHCDVCVQSMHTSCV 95 L +T +H D H ++L Y EN +Y+C++CE E DP+ WFY C CV + H CV Sbjct: 540 LPKTVKHSCDNHPLSLCY--GENATGKYWCDICEAETDPSKWFYTCSKCVVTAHIECV 595 >ref|NP_680208.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|9757816|dbj|BAB08334.1| Ta11-like non-LTR retroelement protein-like [Arabidopsis thaliana] gi|332005633|gb|AED93016.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Length = 664 Score = 61.2 bits (147), Expect = 8e-08 Identities = 25/58 (43%), Positives = 35/58 (60%) Frame = -3 Query: 268 LSRTTRHKLDKHTMNLKYLPVENHKSQYFCEVCEEELDPNGWFYHCDVCVQSMHTSCV 95 L +T +H D H ++L Y EN +Y+C++CE E DP+ WFY C CV + H CV Sbjct: 540 LPKTVKHSCDNHPLSLCY--GENATGKYWCDICEAETDPSKWFYTCSKCVVTAHIECV 595 >gb|ABD65623.1| DC1 domain-containing protein [Brassica oleracea] Length = 635 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/66 (43%), Positives = 41/66 (62%), Gaps = 1/66 (1%) Frame = -3 Query: 292 LHIACALFLSRTTRHKLDK-HTMNLKYLPVENHKSQYFCEVCEEELDPNGWFYHCDVCVQ 116 L + C++ L + +HK DK H + L Y E + QY+CEVCEE+L+P WFY CD C Sbjct: 510 LDVKCSI-LPKMVKHKNDKDHFLTLCY--GEKTREQYWCEVCEEDLNPEKWFYSCDHCGV 566 Query: 115 SMHTSC 98 ++H C Sbjct: 567 TLHIKC 572