BLASTX nr result
ID: Atractylodes21_contig00047223
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00047223 (337 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512723.1| multidrug resistance-associated protein, put... 61 8e-08 ref|XP_002304728.1| multidrug resistance protein ABC transporter... 58 9e-07 >ref|XP_002512723.1| multidrug resistance-associated protein, putative [Ricinus communis] gi|223547734|gb|EEF49226.1| multidrug resistance-associated protein, putative [Ricinus communis] Length = 1395 Score = 61.2 bits (147), Expect = 8e-08 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -3 Query: 335 GLRAAIQVHNNLLKNLVDALVTFFDQTPAGRILHR*SID 219 GLRAAIQVHN LLK L+DA + FFDQTPAGRIL+R S D Sbjct: 902 GLRAAIQVHNTLLKKLIDAPIQFFDQTPAGRILNRFSSD 940 >ref|XP_002304728.1| multidrug resistance protein ABC transporter family [Populus trichocarpa] gi|222842160|gb|EEE79707.1| multidrug resistance protein ABC transporter family [Populus trichocarpa] Length = 1426 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -3 Query: 335 GLRAAIQVHNNLLKNLVDALVTFFDQTPAGRILHR*SID 219 GLRAA+QVHN LL L+DA V FFDQTP GRIL+R S D Sbjct: 848 GLRAAVQVHNTLLNKLIDAPVQFFDQTPGGRILNRFSSD 886