BLASTX nr result
ID: Atractylodes21_contig00047126
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00047126 (317 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_006291838.1| orf49 gene product (mitochondrion) [Daucus c... 60 5e-13 >ref|YP_006291838.1| orf49 gene product (mitochondrion) [Daucus carota subsp. sativus] gi|374081995|gb|AEY81187.1| orf49 (mitochondrion) [Daucus carota subsp. sativus] Length = 161 Score = 60.5 bits (145), Expect(2) = 5e-13 Identities = 32/45 (71%), Positives = 32/45 (71%) Frame = -2 Query: 208 MDSIPYIEHSFLSIDRKIFVKYRTFPFFVFFRIPHIQGSLSQAPH 74 MD IPYIEHSFLSIDRKIFVKYRTFPFF P Q S PH Sbjct: 1 MDPIPYIEHSFLSIDRKIFVKYRTFPFFKNSSYPR-QLITSTPPH 44 Score = 38.5 bits (88), Expect(2) = 5e-13 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 57 GGRSPFESNKVSSRGFIAT 1 GG SPFESNKVSSRGFIAT Sbjct: 49 GGCSPFESNKVSSRGFIAT 67