BLASTX nr result
ID: Atractylodes21_contig00047125
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00047125 (324 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_006291838.1| orf49 gene product (mitochondrion) [Daucus c... 74 2e-11 >ref|YP_006291838.1| orf49 gene product (mitochondrion) [Daucus carota subsp. sativus] gi|374081995|gb|AEY81187.1| orf49 (mitochondrion) [Daucus carota subsp. sativus] Length = 161 Score = 73.6 bits (179), Expect = 2e-11 Identities = 44/66 (66%), Positives = 45/66 (68%), Gaps = 5/66 (7%) Frame = -3 Query: 241 KPHH*NSSANPFLSHRAERTFGTSVGR-----AL***LLSGRRKATSI*KTAGNSIGSPL 77 +PHH N SANPFLSHRAERTFG R A L GRRKATSI KTAGN GSPL Sbjct: 89 RPHHLNLSANPFLSHRAERTFGWYFSRAGCLIAASFFRLVGRRKATSIYKTAGNLRGSPL 148 Query: 76 GAFAGN 59 AFAGN Sbjct: 149 EAFAGN 154