BLASTX nr result
ID: Atractylodes21_contig00047105
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00047105 (351 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI14948.3| unnamed protein product [Vitis vinifera] 83 3e-14 ref|XP_002448053.1| hypothetical protein SORBIDRAFT_06g020256 [S... 83 3e-14 ref|XP_002277458.1| PREDICTED: pentatricopeptide repeat-containi... 83 3e-14 ref|XP_003581359.1| PREDICTED: pentatricopeptide repeat-containi... 82 5e-14 ref|XP_004150015.1| PREDICTED: pentatricopeptide repeat-containi... 81 1e-13 >emb|CBI14948.3| unnamed protein product [Vitis vinifera] Length = 401 Score = 82.8 bits (203), Expect = 3e-14 Identities = 32/38 (84%), Positives = 38/38 (100%) Frame = +1 Query: 1 CHDATKMISKVYNREIIVRDRTRFHHFKDGSCSCNDYW 114 CH+ATK++SKV+NREI+VRDRTRFHHFK+GSCSCNDYW Sbjct: 364 CHNATKLVSKVFNREIVVRDRTRFHHFKEGSCSCNDYW 401 >ref|XP_002448053.1| hypothetical protein SORBIDRAFT_06g020256 [Sorghum bicolor] gi|241939236|gb|EES12381.1| hypothetical protein SORBIDRAFT_06g020256 [Sorghum bicolor] Length = 693 Score = 82.8 bits (203), Expect = 3e-14 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +1 Query: 1 CHDATKMISKVYNREIIVRDRTRFHHFKDGSCSCNDYW 114 CH ATK+ISKVYNREI+VRDR RFHHFKDG+CSCNDYW Sbjct: 656 CHSATKLISKVYNREIVVRDRNRFHHFKDGTCSCNDYW 693 >ref|XP_002277458.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070 [Vitis vinifera] Length = 698 Score = 82.8 bits (203), Expect = 3e-14 Identities = 32/38 (84%), Positives = 38/38 (100%) Frame = +1 Query: 1 CHDATKMISKVYNREIIVRDRTRFHHFKDGSCSCNDYW 114 CH+ATK++SKV+NREI+VRDRTRFHHFK+GSCSCNDYW Sbjct: 661 CHNATKLVSKVFNREIVVRDRTRFHHFKEGSCSCNDYW 698 >ref|XP_003581359.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like, partial [Brachypodium distachyon] Length = 745 Score = 82.0 bits (201), Expect = 5e-14 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +1 Query: 1 CHDATKMISKVYNREIIVRDRTRFHHFKDGSCSCNDYW 114 CH ATK+ISKVYNREIIVRDR RFHHFKDG CSCNDYW Sbjct: 708 CHSATKLISKVYNREIIVRDRNRFHHFKDGLCSCNDYW 745 >ref|XP_004150015.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cucumis sativus] gi|449529868|ref|XP_004171920.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cucumis sativus] Length = 734 Score = 80.9 bits (198), Expect = 1e-13 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +1 Query: 1 CHDATKMISKVYNREIIVRDRTRFHHFKDGSCSCNDYW 114 CH ATK+ISK++NREII RDR RFHHFKDGSCSCNDYW Sbjct: 697 CHSATKLISKIFNREIIARDRNRFHHFKDGSCSCNDYW 734