BLASTX nr result
ID: Atractylodes21_contig00047099
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00047099 (362 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001235061.1| uncharacterized protein LOC100306695 [Glycin... 74 2e-11 ref|XP_002320479.1| predicted protein [Populus trichocarpa] gi|2... 73 2e-11 gb|AFS33549.1| ribosomal protein L30 family protein [Nicotiana t... 73 3e-11 ref|XP_002525322.1| structural constituent of ribosome, putative... 73 3e-11 ref|XP_002302864.1| predicted protein [Populus trichocarpa] gi|2... 72 4e-11 >ref|NP_001235061.1| uncharacterized protein LOC100306695 [Glycine max] gi|255629303|gb|ACU14996.1| unknown [Glycine max] Length = 107 Score = 73.6 bits (179), Expect = 2e-11 Identities = 34/47 (72%), Positives = 41/47 (87%) Frame = -3 Query: 360 GMLQQVKRLVVIETEEMFKARKENQEKHCALRPPLVVSHRPALASDS 220 GMLQQVKRLVVIETEEM+KARK+ +E H ALRPPLV+SH+P +D+ Sbjct: 60 GMLQQVKRLVVIETEEMYKARKQKEEAHRALRPPLVISHKPPSVTDA 106 >ref|XP_002320479.1| predicted protein [Populus trichocarpa] gi|222861252|gb|EEE98794.1| predicted protein [Populus trichocarpa] Length = 105 Score = 73.2 bits (178), Expect = 2e-11 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = -3 Query: 360 GMLQQVKRLVVIETEEMFKARKENQEKHCALRPPLVVSHRPALAS 226 GMLQQVKRLVVIETEEM+KARK+N+ H ALRPPLV++H PA AS Sbjct: 60 GMLQQVKRLVVIETEEMYKARKQNEANHQALRPPLVINHLPASAS 104 >gb|AFS33549.1| ribosomal protein L30 family protein [Nicotiana tabacum] Length = 108 Score = 72.8 bits (177), Expect = 3e-11 Identities = 37/49 (75%), Positives = 40/49 (81%) Frame = -3 Query: 360 GMLQQVKRLVVIETEEMFKARKENQEKHCALRPPLVVSHRPALASDSTQ 214 GMLQQVKRLVVIETEEM+KARKE H ALRPPLVV+H A A+DS Q Sbjct: 60 GMLQQVKRLVVIETEEMYKARKEKLSDHKALRPPLVVNHHAAPAADSVQ 108 >ref|XP_002525322.1| structural constituent of ribosome, putative [Ricinus communis] gi|223535381|gb|EEF37055.1| structural constituent of ribosome, putative [Ricinus communis] Length = 107 Score = 72.8 bits (177), Expect = 3e-11 Identities = 36/48 (75%), Positives = 40/48 (83%) Frame = -3 Query: 360 GMLQQVKRLVVIETEEMFKARKENQEKHCALRPPLVVSHRPALASDST 217 GMLQQVKRLV IETEEM+KARKEN+ KH ALR PLV+ H PA AS S+ Sbjct: 60 GMLQQVKRLVAIETEEMYKARKENEAKHRALRSPLVIKHLPAEASSSS 107 >ref|XP_002302864.1| predicted protein [Populus trichocarpa] gi|222844590|gb|EEE82137.1| predicted protein [Populus trichocarpa] Length = 106 Score = 72.4 bits (176), Expect = 4e-11 Identities = 35/47 (74%), Positives = 40/47 (85%) Frame = -3 Query: 360 GMLQQVKRLVVIETEEMFKARKENQEKHCALRPPLVVSHRPALASDS 220 GMLQQVKRLVVIETEEM+KARK+N H A+RPPLV++H PA AS S Sbjct: 60 GMLQQVKRLVVIETEEMYKARKQNDVNHRAVRPPLVINHLPASASSS 106