BLASTX nr result
ID: Atractylodes21_contig00047097
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00047097 (377 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_173387.1| hypothetical protein NitaMp041 [Nicotiana tabac... 65 4e-09 >ref|YP_173387.1| hypothetical protein NitaMp041 [Nicotiana tabacum] gi|56806550|dbj|BAD83451.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 130 Score = 65.5 bits (158), Expect = 4e-09 Identities = 39/71 (54%), Positives = 44/71 (61%) Frame = -3 Query: 225 VEHAECAGEEGSSNAQLDLDLTLRPPGPTAEEIERELSSFLSSFGNRGVTSSVLQNTKIK 46 + HAE A LDL L L PP PT E +ERELS+FLSSFGNR V VL+ T K Sbjct: 45 IPHAEQA------MGDLDLALRLGPPSPTKEALERELSTFLSSFGNREVRRDVLEGTIRK 98 Query: 45 LQLDVASPAKL 13 L L+ ASP KL Sbjct: 99 LDLNSASPEKL 109