BLASTX nr result
ID: Atractylodes21_contig00047054
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00047054 (332 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003636545.1| Pentatricopeptide repeat-containing protein ... 65 6e-09 ref|XP_003544054.1| PREDICTED: uncharacterized protein LOC100808... 63 3e-08 gb|ABN06064.1| RNA-directed DNA polymerase (Reverse transcriptas... 62 6e-08 gb|ABN08405.1| Peptidase aspartic, active site [Medicago truncat... 59 3e-07 gb|ABN08407.1| Peptidase aspartic, active site [Medicago truncat... 59 3e-07 >ref|XP_003636545.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355502480|gb|AES83683.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 1280 Score = 65.1 bits (157), Expect = 6e-09 Identities = 33/75 (44%), Positives = 44/75 (58%), Gaps = 1/75 (1%) Frame = -3 Query: 291 PPNSDGGGSNQSRNRGFRSLTRTEWEERRRKGLCFCCGLLFGPN-HTCPEADLRVMLLAD 115 P GG R +G RS+ E ERR KGLCF CG + P H CPE LRV++L + Sbjct: 908 PYGKKHGGDRVERWKGVRSIQNGEMAERRAKGLCFKCGGKYHPTLHKCPEKSLRVLILGE 967 Query: 114 DEIISDNGEILCLES 70 E +++ GEI+ LE+ Sbjct: 968 GEGVNEEGEIVSLET 982 >ref|XP_003544054.1| PREDICTED: uncharacterized protein LOC100808652 [Glycine max] Length = 463 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/61 (47%), Positives = 40/61 (65%), Gaps = 1/61 (1%) Frame = -3 Query: 249 RGFRSLTRTEWEERRRKGLCFCCGLLFGPN-HTCPEADLRVMLLADDEIISDNGEILCLE 73 +G RS+ E ERR KGLCF CG + P H CPE LRV++L + E ++D GEI+ +E Sbjct: 297 KGVRSIRNNEMAERRAKGLCFKCGGKYHPTLHKCPERALRVLILGEGEALNDEGEIMAME 356 Query: 72 S 70 + Sbjct: 357 A 357 >gb|ABN06064.1| RNA-directed DNA polymerase (Reverse transcriptase); Chromo; Zinc finger, CCHC-type; Peptidase aspartic, active site; Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula] Length = 1297 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/65 (44%), Positives = 41/65 (63%) Frame = -3 Query: 255 RNRGFRSLTRTEWEERRRKGLCFCCGLLFGPNHTCPEADLRVMLLADDEIISDNGEILCL 76 R+R F L+ E ER++KGLCF CG F P H CP+ LRV++L +DE G++L + Sbjct: 92 RDRSFTHLSYNELMERKQKGLCFKCGGPFHPMHQCPDKQLRVLVLEEDEEGEPEGKLLAV 151 Query: 75 ESDHD 61 E D + Sbjct: 152 EVDDE 156 >gb|ABN08405.1| Peptidase aspartic, active site [Medicago truncatula] Length = 435 Score = 59.3 bits (142), Expect = 3e-07 Identities = 32/75 (42%), Positives = 44/75 (58%) Frame = -3 Query: 255 RNRGFRSLTRTEWEERRRKGLCFCCGLLFGPNHTCPEADLRVMLLADDEIISDNGEILCL 76 R++ RSL+ E +RR+KGLCF CG + P H CP+ +L VM+L DD D E+ L Sbjct: 43 RDKNVRSLSSQEIADRRQKGLCFKCGGPYHPRHQCPDKNLSVMVLEDDS--EDENEVRVL 100 Query: 75 ESDHDVSTRGSGTQV 31 +D DV T Q+ Sbjct: 101 -NDEDVDTGAEELQL 114 >gb|ABN08407.1| Peptidase aspartic, active site [Medicago truncatula] Length = 435 Score = 59.3 bits (142), Expect = 3e-07 Identities = 32/75 (42%), Positives = 44/75 (58%) Frame = -3 Query: 255 RNRGFRSLTRTEWEERRRKGLCFCCGLLFGPNHTCPEADLRVMLLADDEIISDNGEILCL 76 R++ RSL+ E +RR+KGLCF CG + P H CP+ +L VM+L DD D E+ L Sbjct: 43 RDKNVRSLSSQEIADRRQKGLCFKCGGPYHPRHQCPDKNLSVMVLEDDS--EDENEVRVL 100 Query: 75 ESDHDVSTRGSGTQV 31 +D DV T Q+ Sbjct: 101 -NDEDVDTGAEELQL 114