BLASTX nr result
ID: Atractylodes21_contig00046859
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00046859 (257 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529530.1| conserved hypothetical protein [Ricinus comm... 50 1e-09 ref|YP_004222277.1| hypothetical protein BevumaM_p039 [Beta vulg... 59 3e-07 >ref|XP_002529530.1| conserved hypothetical protein [Ricinus communis] gi|223531014|gb|EEF32868.1| conserved hypothetical protein [Ricinus communis] Length = 126 Score = 50.4 bits (119), Expect(2) = 1e-09 Identities = 20/25 (80%), Positives = 24/25 (96%) Frame = +3 Query: 27 CNSPPVAEDRVTVHTRVFQFLRKLF 101 CNSPP+AE+R+T+HTRVFQFLRK F Sbjct: 36 CNSPPIAEERITIHTRVFQFLRKHF 60 Score = 37.0 bits (84), Expect(2) = 1e-09 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = +2 Query: 86 LTEALSYQSSSTTAVSYLIARRVAFFI 166 L + SYQSSSTTAVSYLIARR F+ Sbjct: 56 LRKHFSYQSSSTTAVSYLIARREWLFL 82 >ref|YP_004222277.1| hypothetical protein BevumaM_p039 [Beta vulgaris subsp. maritima] gi|346683152|ref|YP_004842084.1| hypothetical protein BemaM_p037 [Beta macrocarpa] gi|317905712|emb|CBX33240.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439792|emb|CBX33292.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148721|emb|CBJ23359.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500070|emb|CBX24886.1| hypothetical protein [Beta macrocarpa] gi|384939198|emb|CBL52045.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 102 Score = 59.3 bits (142), Expect = 3e-07 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +3 Query: 63 VHTRVFQFLRKLFLTSQVVQQLYLIL*PGGSPFSFSR 173 VHT + QFLRKLFLTSQVVQQLYLI GGSPF FSR Sbjct: 66 VHTILLQFLRKLFLTSQVVQQLYLIARRGGSPFEFSR 102