BLASTX nr result
ID: Atractylodes21_contig00046673
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00046673 (308 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADN33687.1| A/G-specific adenine DNA glycosylase [Cucumis mel... 57 2e-06 ref|XP_002863220.1| predicted protein [Arabidopsis lyrata subsp.... 55 4e-06 >gb|ADN33687.1| A/G-specific adenine DNA glycosylase [Cucumis melo subsp. melo] Length = 401 Score = 56.6 bits (135), Expect = 2e-06 Identities = 30/59 (50%), Positives = 36/59 (61%) Frame = +3 Query: 132 TKSNKRTRKPKPEPGFPIGDIEDFQFREDEVGEIRASLLKWYDVNKRDLPWRRINDDGE 308 TK +R+R P + DIED F D V IRASLL WYD ++RDLPWR + D GE Sbjct: 27 TKRKRRSRSPSKSEA--VVDIEDIMFSIDNVQTIRASLLDWYDRSRRDLPWRSL-DKGE 82 >ref|XP_002863220.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297309054|gb|EFH39479.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 495 Score = 55.5 bits (132), Expect = 4e-06 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 1/59 (1%) Frame = +3 Query: 135 KSNKRTRKPKPEPGFPIG-DIEDFQFREDEVGEIRASLLKWYDVNKRDLPWRRINDDGE 308 K ++ RK + E P+G DIED F E+E +IR +L WYDVN+RDLPWR+ + E Sbjct: 48 KLMRKCRKKREEEEEPLGGDIEDL-FSENETEKIRMGMLDWYDVNQRDLPWRKRRSESE 105