BLASTX nr result
ID: Atractylodes21_contig00046665
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00046665 (278 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002439619.1| hypothetical protein SORBIDRAFT_09g016870 [S... 55 6e-06 >ref|XP_002439619.1| hypothetical protein SORBIDRAFT_09g016870 [Sorghum bicolor] gi|241944904|gb|EES18049.1| hypothetical protein SORBIDRAFT_09g016870 [Sorghum bicolor] Length = 100 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -2 Query: 127 YLFALVMDEFTKDIQDEISWFMLFADDIVMIDE 29 YLFALVMDE T+DIQ I W MLFADD+V++DE Sbjct: 52 YLFALVMDEVTRDIQGNIPWCMLFADDVVLVDE 84