BLASTX nr result
ID: Atractylodes21_contig00046515
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00046515 (315 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274643.2| PREDICTED: methyl-CpG-binding domain-contain... 70 1e-10 ref|XP_002517349.1| DNA binding protein, putative [Ricinus commu... 62 4e-08 >ref|XP_002274643.2| PREDICTED: methyl-CpG-binding domain-containing protein 9-like [Vitis vinifera] Length = 2164 Score = 70.5 bits (171), Expect = 1e-10 Identities = 42/99 (42%), Positives = 57/99 (57%) Frame = +1 Query: 1 ISEKQGVLGDGWRVKFEYSESTCRTSAIYLSPDGARFDSMSEVARRLGLIPTYDSFETED 180 ISE+ GVL +GWRV+ + S ++ +PDG F+SMSEVA LGL +S +TE Sbjct: 253 ISERHGVLEEGWRVELKQSVRAGELCPVFCAPDGRIFESMSEVAVYLGLTSNCNSVDTEI 312 Query: 181 EGSDIILLQKGSHSTKRTKDTLRSQRANNLREHKNTLRT 297 L+K SH +KR K T R AN+ E+K+ L T Sbjct: 313 RSDGSASLKKRSHLSKRRKST-RLSIANSSAENKDALLT 350 >ref|XP_002517349.1| DNA binding protein, putative [Ricinus communis] gi|223543360|gb|EEF44891.1| DNA binding protein, putative [Ricinus communis] Length = 2145 Score = 62.4 bits (150), Expect = 4e-08 Identities = 41/97 (42%), Positives = 51/97 (52%) Frame = +1 Query: 1 ISEKQGVLGDGWRVKFEYSESTCRTSAIYLSPDGARFDSMSEVARRLGLIPTYDSFETED 180 ISE+ G+L +GW V+ + S S C Y SPDG F SM+EVA LGL P+ T Sbjct: 278 ISERHGILDEGWHVELKNSVSGCEVFVAYCSPDGKTFGSMAEVACYLGLTPS-----TRS 332 Query: 181 EGSDIILLQKGSHSTKRTKDTLRSQRANNLREHKNTL 291 +GS LQ+ H K+ K T R AN E K L Sbjct: 333 DGSP--SLQERLHLPKKRK-TKRFSLANGYAETKQAL 366