BLASTX nr result
ID: Atractylodes21_contig00045855
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00045855 (357 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN80320.1| hypothetical protein VITISV_034560 [Vitis vinifera] 59 5e-07 dbj|BAA78425.1| polyprotein [Arabidopsis thaliana] gi|338746551|... 58 7e-07 dbj|BAK41507.1| polyprotein [Arabidopsis thaliana] 58 7e-07 gb|ACP30598.1| disease resistance protein [Brassica rapa subsp. ... 58 7e-07 emb|CAN69647.1| hypothetical protein VITISV_022133 [Vitis vinifera] 58 7e-07 >emb|CAN80320.1| hypothetical protein VITISV_034560 [Vitis vinifera] Length = 1261 Score = 58.5 bits (140), Expect = 5e-07 Identities = 37/96 (38%), Positives = 54/96 (56%), Gaps = 1/96 (1%) Frame = +2 Query: 2 YDLLKV*GCACFVMLQPYERFKLKPRSRLCYFLGYGIEYK*YR-FENLSLNVFVSLVTMI 178 Y L+ G ACFV+LQP+E KL+P+SRLC FLGYG K YR ++ +S + VS + Sbjct: 612 YHHLRSFGSACFVLLQPHEHNKLEPQSRLCCFLGYGETQKGYRCYDPVSHRLRVSRNVVF 671 Query: 179 SGNATLSPLPLSKFQVGSSTIVPFFTDASIDLSPTT 286 + L + + +S+++ F D SI S T Sbjct: 672 WEHRLFVELSHFRSSLTNSSVLEIFPDESIVPSTNT 707 >dbj|BAA78425.1| polyprotein [Arabidopsis thaliana] gi|338746551|dbj|BAK41505.1| polyprotein [Arabidopsis thaliana] gi|338746553|dbj|BAK41506.1| polyprotein [Arabidopsis thaliana] gi|338746557|dbj|BAK41508.1| polyprotein [Arabidopsis thaliana] gi|338746559|dbj|BAK41509.1| polyprotein [Arabidopsis thaliana] Length = 1447 Score = 58.2 bits (139), Expect = 7e-07 Identities = 41/123 (33%), Positives = 58/123 (47%), Gaps = 9/123 (7%) Frame = +2 Query: 2 YDLLKV*GCACFVMLQPYERFKLKPRSRLCYFLGYGIEYK*YRFENLSLN-VFVSLVTMI 178 YD L+V GCAC+ L+PY + KL +SR C FLGY + Y +L + +++S Sbjct: 666 YDKLRVFGCACYPWLRPYNQHKLDDKSRQCVFLGYSLTQSAYLCLHLQTSRIYISRHVRF 725 Query: 179 SGN--------ATLSPLPLSKFQVGSSTIVPFFTDASIDLSPTTTHILTEPTSSESEHTQ 334 N ATLSP+ + + S P T PT T +L P+ S+ H Sbjct: 726 DENCFPFSNYLATLSPVQEQR-RESSCVWSPHTT------LPTRTPVLPAPSCSDPHHAA 778 Query: 335 TTP 343 T P Sbjct: 779 TPP 781 >dbj|BAK41507.1| polyprotein [Arabidopsis thaliana] Length = 1447 Score = 58.2 bits (139), Expect = 7e-07 Identities = 41/123 (33%), Positives = 58/123 (47%), Gaps = 9/123 (7%) Frame = +2 Query: 2 YDLLKV*GCACFVMLQPYERFKLKPRSRLCYFLGYGIEYK*YRFENLSLN-VFVSLVTMI 178 YD L+V GCAC+ L+PY + KL +SR C FLGY + Y +L + +++S Sbjct: 666 YDKLRVFGCACYPWLRPYNQHKLDDKSRQCVFLGYSLTQSAYLCLHLQTSRIYISRHVRF 725 Query: 179 SGN--------ATLSPLPLSKFQVGSSTIVPFFTDASIDLSPTTTHILTEPTSSESEHTQ 334 N ATLSP+ + + S P T PT T +L P+ S+ H Sbjct: 726 DENCFPFSNYLATLSPVQEQR-RESSCVWSPHTT------LPTRTPVLPAPSCSDPHHAA 778 Query: 335 TTP 343 T P Sbjct: 779 TPP 781 >gb|ACP30598.1| disease resistance protein [Brassica rapa subsp. pekinensis] Length = 2301 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/43 (60%), Positives = 31/43 (72%) Frame = +2 Query: 2 YDLLKV*GCACFVMLQPYERFKLKPRSRLCYFLGYGIEYK*YR 130 YD L++ GCACF ML+PY + KL PRS C FLGY +YK YR Sbjct: 685 YDALRIFGCACFPMLRPYTQNKLDPRSLQCVFLGYSEKYKGYR 727 >emb|CAN69647.1| hypothetical protein VITISV_022133 [Vitis vinifera] Length = 2655 Score = 58.2 bits (139), Expect = 7e-07 Identities = 36/96 (37%), Positives = 53/96 (55%), Gaps = 1/96 (1%) Frame = +2 Query: 2 YDLLKV*GCACFVMLQPYERFKLKPRSRLCYFLGYGIEYK*YR-FENLSLNVFVSLVTMI 178 Y L+ G CFV+LQP+E KL+PRSRLC FLGYG K YR ++ +S + VS + Sbjct: 1993 YHHLRSFGSXCFVLLQPHEHNKLEPRSRLCCFLGYGETQKGYRCYDPVSHRLHVSRNVVF 2052 Query: 179 SGNATLSPLPLSKFQVGSSTIVPFFTDASIDLSPTT 286 + L + + +S+++ F D S+ S T Sbjct: 2053 WEHRLFVELSHFRSSLTNSSVLEIFLDESLVPSTNT 2088