BLASTX nr result
ID: Atractylodes21_contig00045838
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00045838 (244 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513838.1| myst histone acetyltransferase, putative [Ri... 103 1e-20 dbj|BAA32822.1| 181 [Daucus carota] 102 4e-20 ref|NP_196536.1| MYST-like histone acetyltransferase 2 [Arabidop... 100 9e-20 dbj|BAC41804.1| putative embryogenic callus protein [Arabidopsis... 100 9e-20 ref|XP_002307411.1| histone acetyltransferase [Populus trichocar... 100 9e-20 >ref|XP_002513838.1| myst histone acetyltransferase, putative [Ricinus communis] gi|223546924|gb|EEF48421.1| myst histone acetyltransferase, putative [Ricinus communis] Length = 445 Score = 103 bits (257), Expect = 1e-20 Identities = 48/65 (73%), Positives = 53/65 (81%) Frame = +1 Query: 49 TRIQSSSWKTTARENMQMLPLEVGTRVMCRWRDGKYHPVKVIERRKLQSGGPNDYEYYVH 228 T I+S S K + +LPLEVGTRVMCRWRDGKYH VKVIERR++Q GGPNDYEYYVH Sbjct: 43 TMIESESLK---KRKASILPLEVGTRVMCRWRDGKYHQVKVIERRRMQCGGPNDYEYYVH 99 Query: 229 YTEFN 243 YTEFN Sbjct: 100 YTEFN 104 >dbj|BAA32822.1| 181 [Daucus carota] Length = 433 Score = 102 bits (253), Expect = 4e-20 Identities = 46/68 (67%), Positives = 56/68 (82%) Frame = +1 Query: 40 FVRTRIQSSSWKTTARENMQMLPLEVGTRVMCRWRDGKYHPVKVIERRKLQSGGPNDYEY 219 FV T+ ++ S++ + MLPLEVGTRV+CRWRD K+HPVKVIERR++ SGGPNDYEY Sbjct: 28 FVVTQPENESYR---KRKSSMLPLEVGTRVLCRWRDSKHHPVKVIERRRVPSGGPNDYEY 84 Query: 220 YVHYTEFN 243 YVHYTEFN Sbjct: 85 YVHYTEFN 92 >ref|NP_196536.1| MYST-like histone acetyltransferase 2 [Arabidopsis thaliana] gi|75180828|sp|Q9LXD7.1|MYST2_ARATH RecName: Full=MYST-like histone acetyltransferase 2 gi|7671415|emb|CAB89356.1| embryogenic callus protein-like [Arabidopsis thaliana] gi|9759005|dbj|BAB09532.1| embryogenic callus protein 181; contains similarity to histone acetyltransferase [Arabidopsis thaliana] gi|225898903|dbj|BAH30582.1| hypothetical protein [Arabidopsis thaliana] gi|332004057|gb|AED91440.1| MYST-like histone acetyltransferase 2 [Arabidopsis thaliana] Length = 445 Score = 100 bits (250), Expect = 9e-20 Identities = 43/53 (81%), Positives = 48/53 (90%) Frame = +1 Query: 85 RENMQMLPLEVGTRVMCRWRDGKYHPVKVIERRKLQSGGPNDYEYYVHYTEFN 243 + M MLPLEVGTRVMCRWRDGK+HPVKVIERR++ +GG NDYEYYVHYTEFN Sbjct: 52 KRKMGMLPLEVGTRVMCRWRDGKHHPVKVIERRRIHNGGQNDYEYYVHYTEFN 104 >dbj|BAC41804.1| putative embryogenic callus protein [Arabidopsis thaliana] Length = 367 Score = 100 bits (250), Expect = 9e-20 Identities = 43/53 (81%), Positives = 48/53 (90%) Frame = +1 Query: 85 RENMQMLPLEVGTRVMCRWRDGKYHPVKVIERRKLQSGGPNDYEYYVHYTEFN 243 + M MLPLEVGTRVMCRWRDGK+HPVKVIERR++ +GG NDYEYYVHYTEFN Sbjct: 52 KRKMGMLPLEVGTRVMCRWRDGKHHPVKVIERRRIHNGGQNDYEYYVHYTEFN 104 >ref|XP_002307411.1| histone acetyltransferase [Populus trichocarpa] gi|222856860|gb|EEE94407.1| histone acetyltransferase [Populus trichocarpa] Length = 448 Score = 100 bits (250), Expect = 9e-20 Identities = 44/53 (83%), Positives = 47/53 (88%) Frame = +1 Query: 85 RENMQMLPLEVGTRVMCRWRDGKYHPVKVIERRKLQSGGPNDYEYYVHYTEFN 243 + MLPLEVGTRV+CRWRD KYHPVKVIERRK+QSGG NDYEYYVHYTEFN Sbjct: 55 KRKTSMLPLEVGTRVLCRWRDCKYHPVKVIERRKMQSGGTNDYEYYVHYTEFN 107