BLASTX nr result
ID: Atractylodes21_contig00045771
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00045771 (232 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534446.1| transcription factor, putative [Ricinus comm... 67 2e-09 ref|XP_002319791.1| predicted protein [Populus trichocarpa] gi|2... 62 6e-08 ref|XP_002317553.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 >ref|XP_002534446.1| transcription factor, putative [Ricinus communis] gi|223525277|gb|EEF27938.1| transcription factor, putative [Ricinus communis] Length = 305 Score = 66.6 bits (161), Expect = 2e-09 Identities = 36/57 (63%), Positives = 42/57 (73%), Gaps = 1/57 (1%) Frame = -3 Query: 170 EFSVNSPPKVQPPNIATQLHFSNNARFWNASAASMNDVRSSFF-PLQVQSPSSTMED 3 +F NSPPK P + QLHFSNNA FWNASA+SMNDV SFF PLQ Q P+S+ E+ Sbjct: 100 QFLRNSPPKQSPQS---QLHFSNNAPFWNASASSMNDVCPSFFPPLQQQFPTSSYEE 153 >ref|XP_002319791.1| predicted protein [Populus trichocarpa] gi|222858167|gb|EEE95714.1| predicted protein [Populus trichocarpa] Length = 444 Score = 61.6 bits (148), Expect = 6e-08 Identities = 34/63 (53%), Positives = 42/63 (66%), Gaps = 1/63 (1%) Frame = -3 Query: 188 YPPAPQEFSVNSPPKVQPPNIATQLHFSNNARFWNASAASMNDVRSSFFP-LQVQSPSST 12 +P PQ F NSPPK N QLHFSNN FWNASA++MNDVR S+FP +Q Q +S Sbjct: 242 WPKGPQ-FLRNSPPKQTSSN---QLHFSNNTPFWNASASAMNDVRPSYFPSMQPQFATSN 297 Query: 11 MED 3 ++ Sbjct: 298 FDE 300 >ref|XP_002317553.1| predicted protein [Populus trichocarpa] gi|222860618|gb|EEE98165.1| predicted protein [Populus trichocarpa] Length = 451 Score = 59.7 bits (143), Expect = 2e-07 Identities = 32/57 (56%), Positives = 42/57 (73%), Gaps = 1/57 (1%) Frame = -3 Query: 170 EFSVNSPPKVQPPNIATQLHFSNNARFWNASAASMNDVRSSFFP-LQVQSPSSTMED 3 +F NSPPK QPP+ QLH SNNA FWNAS+++M+DVR SFFP +Q Q +S ++ Sbjct: 249 QFLRNSPPK-QPPH--NQLHLSNNAPFWNASSSAMSDVRPSFFPSMQPQFTTSNFDE 302