BLASTX nr result
ID: Atractylodes21_contig00045763
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00045763 (336 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004170265.1| PREDICTED: probable leucine-rich repeat rece... 62 4e-08 ref|XP_004143652.1| PREDICTED: LOW QUALITY PROTEIN: protein NSP-... 62 4e-08 ref|XP_003536190.1| PREDICTED: LRR receptor-like serine/threonin... 54 1e-05 >ref|XP_004170265.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Cucumis sativus] Length = 679 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -1 Query: 117 GNAELRALMDIKASLDPHNTYLGSWTVLGNKCSSFEGVG 1 GN EL+ALMD+KA+LDP N YL SWT G+ CSSFEG+G Sbjct: 24 GNEELQALMDLKAALDPDNQYLASWTANGDPCSSFEGIG 62 >ref|XP_004143652.1| PREDICTED: LOW QUALITY PROTEIN: protein NSP-INTERACTING KINASE 3-like [Cucumis sativus] Length = 684 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -1 Query: 117 GNAELRALMDIKASLDPHNTYLGSWTVLGNKCSSFEGVG 1 GN EL+ALMD+KA+LDP N YL SWT G+ CSSFEG+G Sbjct: 24 GNEELQALMDLKAALDPDNQYLASWTANGDPCSSFEGIG 62 >ref|XP_003536190.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Glycine max] Length = 677 Score = 54.3 bits (129), Expect = 1e-05 Identities = 26/39 (66%), Positives = 31/39 (79%), Gaps = 1/39 (2%) Frame = -1 Query: 117 GNAELRALMDIKASLDPHNTYLGSWTVLGNKC-SSFEGV 4 GN ELRALMD+KASLDP + YL SW++ G+ C SFEGV Sbjct: 24 GNGELRALMDMKASLDPESLYLPSWSINGDPCDGSFEGV 62