BLASTX nr result
ID: Atractylodes21_contig00045717
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00045717 (311 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003619586.1| hypothetical protein MTR_6g059820 [Medicago ... 142 3e-32 ref|XP_003549152.1| PREDICTED: pentatricopeptide repeat-containi... 141 5e-32 ref|XP_002264078.2| PREDICTED: pentatricopeptide repeat-containi... 131 5e-29 ref|XP_004141609.1| PREDICTED: pentatricopeptide repeat-containi... 125 4e-27 ref|XP_002529628.1| pentatricopeptide repeat-containing protein,... 125 5e-27 >ref|XP_003619586.1| hypothetical protein MTR_6g059820 [Medicago truncatula] gi|355494601|gb|AES75804.1| hypothetical protein MTR_6g059820 [Medicago truncatula] Length = 528 Score = 142 bits (358), Expect = 3e-32 Identities = 62/93 (66%), Positives = 79/93 (84%) Frame = +2 Query: 5 DLAEIAVKKLIEIDPNNGGYGTMLANIYGALGEWDKARKAWRRLKEQKAYKIPGCSWIEI 184 DLAE A KKL+EIDP+NGGYGTMLANIYG LG+WD+ R W +LK+QK+YKIPGCSWIE+ Sbjct: 431 DLAEFAAKKLVEIDPHNGGYGTMLANIYGQLGKWDEMRNVWSKLKQQKSYKIPGCSWIEV 490 Query: 185 DNQVHQFYSSDDSHFKIEDIHSILESIFGFSDE 283 D++VHQF+S D S+ K E++++ILES+FG E Sbjct: 491 DDKVHQFFSLDQSNPKTEELYNILESLFGNGSE 523 >ref|XP_003549152.1| PREDICTED: pentatricopeptide repeat-containing protein At1g33350-like [Glycine max] Length = 522 Score = 141 bits (356), Expect = 5e-32 Identities = 62/93 (66%), Positives = 77/93 (82%) Frame = +2 Query: 5 DLAEIAVKKLIEIDPNNGGYGTMLANIYGALGEWDKARKAWRRLKEQKAYKIPGCSWIEI 184 DLAE A KKLIEIDP+NGGY MLAN+YG LG+WD+ R WR LK+QK+YK+PGCSWIE+ Sbjct: 425 DLAEFAAKKLIEIDPHNGGYRIMLANVYGELGKWDEVRNVWRTLKQQKSYKVPGCSWIEV 484 Query: 185 DNQVHQFYSSDDSHFKIEDIHSILESIFGFSDE 283 D+QVHQFYS D S+ K ED++ +LES+ GF +E Sbjct: 485 DDQVHQFYSLDKSNPKTEDLYIVLESLVGFRNE 517 >ref|XP_002264078.2| PREDICTED: pentatricopeptide repeat-containing protein At1g33350-like [Vitis vinifera] Length = 573 Score = 131 bits (330), Expect = 5e-29 Identities = 59/87 (67%), Positives = 73/87 (83%) Frame = +2 Query: 5 DLAEIAVKKLIEIDPNNGGYGTMLANIYGALGEWDKARKAWRRLKEQKAYKIPGCSWIEI 184 DLAE ++KKLI++DPNNGGYG MLANIYG LG+WD+ RK + LKEQ A+K PGCSWIEI Sbjct: 483 DLAEFSIKKLIDMDPNNGGYGIMLANIYGELGKWDEVRKVRKVLKEQNAHKTPGCSWIEI 542 Query: 185 DNQVHQFYSSDDSHFKIEDIHSILESI 265 DNQVHQFYS D +H + E+I++ LES+ Sbjct: 543 DNQVHQFYSVDKTHPRTEEIYNTLESL 569 >ref|XP_004141609.1| PREDICTED: pentatricopeptide repeat-containing protein At1g33350-like [Cucumis sativus] gi|449510706|ref|XP_004163739.1| PREDICTED: pentatricopeptide repeat-containing protein At1g33350-like [Cucumis sativus] Length = 563 Score = 125 bits (314), Expect = 4e-27 Identities = 58/90 (64%), Positives = 69/90 (76%) Frame = +2 Query: 5 DLAEIAVKKLIEIDPNNGGYGTMLANIYGALGEWDKARKAWRRLKEQKAYKIPGCSWIEI 184 DLAE +VKKLIE+DP NGGY MLANIY G+WD+ RK R LKE+ AYK PGCSWIE+ Sbjct: 473 DLAEYSVKKLIEMDPKNGGYRIMLANIYAEFGKWDEVRKVRRLLKEKNAYKTPGCSWIEV 532 Query: 185 DNQVHQFYSSDDSHFKIEDIHSILESIFGF 274 DNQV+QFYS D SH +E+I+ LES+ F Sbjct: 533 DNQVYQFYSFDMSHPSVEEIYKTLESMISF 562 >ref|XP_002529628.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223530913|gb|EEF32773.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 400 Score = 125 bits (313), Expect = 5e-27 Identities = 56/87 (64%), Positives = 70/87 (80%) Frame = +2 Query: 5 DLAEIAVKKLIEIDPNNGGYGTMLANIYGALGEWDKARKAWRRLKEQKAYKIPGCSWIEI 184 DLAE A+KKLIEIDP NGGYG MLAN+YG LG+WD+ RK + LK+ AYK PGCSWIE+ Sbjct: 309 DLAESAIKKLIEIDPKNGGYGIMLANLYGGLGKWDEVRKVRKMLKDHNAYKTPGCSWIEV 368 Query: 185 DNQVHQFYSSDDSHFKIEDIHSILESI 265 DN+V QFYS D +H + E+I+ ILE++ Sbjct: 369 DNEVCQFYSVDKTHPRSEEIYRILENL 395