BLASTX nr result
ID: Atractylodes21_contig00045551
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00045551 (319 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD13216.1| latex-abundant protein [Hevea brasiliensis] 62 6e-08 gb|ADM52185.1| type II metacaspase [Hevea brasiliensis] 62 6e-08 ref|XP_002316158.1| predicted protein [Populus trichocarpa] gi|2... 57 1e-06 >gb|AAD13216.1| latex-abundant protein [Hevea brasiliensis] Length = 417 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +3 Query: 6 VGNHELVTKAQKLLKKQWFTQRLGLFCNDDHVEASFVC 119 V N ELV KA+K+LKKQ FTQ+ GL+C+DDHVEASFVC Sbjct: 380 VTNQELVLKARKMLKKQGFTQKPGLYCSDDHVEASFVC 417 >gb|ADM52185.1| type II metacaspase [Hevea brasiliensis] Length = 417 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +3 Query: 6 VGNHELVTKAQKLLKKQWFTQRLGLFCNDDHVEASFVC 119 V N ELV KA+K+LKKQ FTQ+ GL+C+DDHVEASFVC Sbjct: 380 VTNQELVLKARKMLKKQGFTQKPGLYCSDDHVEASFVC 417 >ref|XP_002316158.1| predicted protein [Populus trichocarpa] gi|222865198|gb|EEF02329.1| predicted protein [Populus trichocarpa] Length = 422 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = +3 Query: 6 VGNHELVTKAQKLLKKQWFTQRLGLFCNDDHVEASFVC 119 + N ELV +A+K+LKKQ FTQR GL+C+D HVEA FVC Sbjct: 385 ISNQELVLRARKILKKQGFTQRPGLYCSDHHVEAPFVC 422