BLASTX nr result
ID: Atractylodes21_contig00045405
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00045405 (226 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003554974.1| PREDICTED: uncharacterized protein LOC100817... 112 2e-23 ref|XP_002305969.1| hypothetical protein POPTRDRAFT_1076074 [Pop... 112 3e-23 ref|XP_003543902.1| PREDICTED: uncharacterized protein LOC100814... 111 7e-23 gb|AFK46297.1| unknown [Medicago truncatula] 110 9e-23 ref|XP_003541243.1| PREDICTED: uncharacterized protein LOC100811... 110 1e-22 >ref|XP_003554974.1| PREDICTED: uncharacterized protein LOC100817694 [Glycine max] Length = 435 Score = 112 bits (281), Expect = 2e-23 Identities = 49/75 (65%), Positives = 62/75 (82%) Frame = +1 Query: 1 PTHFEGGEWNKGGDCPRKRPFKYNEIRLDGTNLELYLAQMEEFKRAEKMAKESGLKLRLL 180 P+HFE G+WN+GG+C R +PF+ NE RL+ TNLELY+ Q+EEFK+AEK ++ GLKL+LL Sbjct: 307 PSHFENGKWNQGGNCVRTKPFRSNETRLESTNLELYMIQLEEFKKAEKEGRKKGLKLKLL 366 Query: 181 DITGPMLLRPDGHPS 225 D T MLLRPDGHPS Sbjct: 367 DTTQAMLLRPDGHPS 381 >ref|XP_002305969.1| hypothetical protein POPTRDRAFT_1076074 [Populus trichocarpa] gi|222848933|gb|EEE86480.1| hypothetical protein POPTRDRAFT_1076074 [Populus trichocarpa] Length = 441 Score = 112 bits (280), Expect = 3e-23 Identities = 50/75 (66%), Positives = 59/75 (78%) Frame = +1 Query: 1 PTHFEGGEWNKGGDCPRKRPFKYNEIRLDGTNLELYLAQMEEFKRAEKMAKESGLKLRLL 180 P+HFE GEWNKGG+C R+RPF+ NE L+G N ELY+ Q+EEFK AEK K+ GL+ RLL Sbjct: 309 PSHFENGEWNKGGNCVRRRPFRSNETSLEGINFELYMTQLEEFKLAEKEGKKRGLRFRLL 368 Query: 181 DITGPMLLRPDGHPS 225 D T MLLRPDGHPS Sbjct: 369 DTTQAMLLRPDGHPS 383 >ref|XP_003543902.1| PREDICTED: uncharacterized protein LOC100814731 [Glycine max] Length = 433 Score = 111 bits (277), Expect = 7e-23 Identities = 50/75 (66%), Positives = 59/75 (78%) Frame = +1 Query: 1 PTHFEGGEWNKGGDCPRKRPFKYNEIRLDGTNLELYLAQMEEFKRAEKMAKESGLKLRLL 180 P+HFE G WNKGG C R +PFK NEIRL+GTNLELY+ Q+EEFK A+K ++ GL+ RL Sbjct: 305 PSHFENGTWNKGGHCVRTKPFKSNEIRLEGTNLELYMIQLEEFKIAKKEGRKKGLEFRLF 364 Query: 181 DITGPMLLRPDGHPS 225 D T MLLRPDGHPS Sbjct: 365 DTTQAMLLRPDGHPS 379 >gb|AFK46297.1| unknown [Medicago truncatula] Length = 182 Score = 110 bits (276), Expect = 9e-23 Identities = 49/75 (65%), Positives = 61/75 (81%) Frame = +1 Query: 1 PTHFEGGEWNKGGDCPRKRPFKYNEIRLDGTNLELYLAQMEEFKRAEKMAKESGLKLRLL 180 P+HFE G WN+GG+C R +PFK NE RL+GTN+ELY+ Q+EE+K ++K AK +GLK RLL Sbjct: 57 PSHFENGIWNQGGNCLRTKPFKSNEARLEGTNMELYMIQLEEYKISQKKAKRNGLKFRLL 116 Query: 181 DITGPMLLRPDGHPS 225 D T MLLRPDGHPS Sbjct: 117 DTTQAMLLRPDGHPS 131 >ref|XP_003541243.1| PREDICTED: uncharacterized protein LOC100811842 [Glycine max] Length = 426 Score = 110 bits (275), Expect = 1e-22 Identities = 49/75 (65%), Positives = 61/75 (81%) Frame = +1 Query: 1 PTHFEGGEWNKGGDCPRKRPFKYNEIRLDGTNLELYLAQMEEFKRAEKMAKESGLKLRLL 180 P+HFE G WN+GG+C R +P + NE RL+GTNLELY+ Q+EEFK+AEK ++ GLKL+LL Sbjct: 306 PSHFENGIWNQGGNCVRTKPSRSNETRLEGTNLELYMIQLEEFKKAEKEGRKKGLKLKLL 365 Query: 181 DITGPMLLRPDGHPS 225 D T MLLRPDGHPS Sbjct: 366 DTTQAMLLRPDGHPS 380