BLASTX nr result
ID: Atractylodes21_contig00045357
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00045357 (272 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284562.1| PREDICTED: probable ADP-ribosylation factor ... 92 4e-17 ref|XP_003634688.1| PREDICTED: probable ADP-ribosylation factor ... 92 4e-17 ref|XP_002531044.1| Stromal membrane-associated protein, putativ... 92 6e-17 ref|XP_004150098.1| PREDICTED: probable ADP-ribosylation factor ... 91 1e-16 ref|XP_002316931.1| predicted protein [Populus trichocarpa] gi|2... 90 2e-16 >ref|XP_002284562.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD5-like isoform 1 [Vitis vinifera] Length = 475 Score = 92.0 bits (227), Expect = 4e-17 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -1 Query: 140 MNQKARVTKELNEKHRKILEGLLKLPENRECADCKSKGPRWASVNL 3 MN+KA VTKELN +HRKILEGLLKLPENRECADCKSKGPRWASVNL Sbjct: 1 MNEKANVTKELNARHRKILEGLLKLPENRECADCKSKGPRWASVNL 46 >ref|XP_003634688.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD5-like isoform 2 [Vitis vinifera] gi|302143074|emb|CBI20369.3| unnamed protein product [Vitis vinifera] Length = 478 Score = 92.0 bits (227), Expect = 4e-17 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -1 Query: 140 MNQKARVTKELNEKHRKILEGLLKLPENRECADCKSKGPRWASVNL 3 MN+KA VTKELN +HRKILEGLLKLPENRECADCKSKGPRWASVNL Sbjct: 1 MNEKANVTKELNARHRKILEGLLKLPENRECADCKSKGPRWASVNL 46 >ref|XP_002531044.1| Stromal membrane-associated protein, putative [Ricinus communis] gi|223529372|gb|EEF31337.1| Stromal membrane-associated protein, putative [Ricinus communis] Length = 482 Score = 91.7 bits (226), Expect = 6e-17 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -1 Query: 140 MNQKARVTKELNEKHRKILEGLLKLPENRECADCKSKGPRWASVNL 3 MN+KA V+KELN KHRKILEGLLKLPENRECADCKSKGPRWASVNL Sbjct: 1 MNEKANVSKELNAKHRKILEGLLKLPENRECADCKSKGPRWASVNL 46 >ref|XP_004150098.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD5-like [Cucumis sativus] Length = 510 Score = 90.9 bits (224), Expect = 1e-16 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = -1 Query: 140 MNQKARVTKELNEKHRKILEGLLKLPENRECADCKSKGPRWASVNL 3 MN+KA VTKELN +HRKILEGLLKLPENRECADCK+KGPRWASVNL Sbjct: 1 MNEKANVTKELNARHRKILEGLLKLPENRECADCKAKGPRWASVNL 46 >ref|XP_002316931.1| predicted protein [Populus trichocarpa] gi|222859996|gb|EEE97543.1| predicted protein [Populus trichocarpa] Length = 492 Score = 90.1 bits (222), Expect = 2e-16 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -1 Query: 140 MNQKARVTKELNEKHRKILEGLLKLPENRECADCKSKGPRWASVNL 3 MNQKA V+KELN +HRK+LEGLLKLPENRECADCK+KGPRWASVNL Sbjct: 1 MNQKANVSKELNARHRKVLEGLLKLPENRECADCKAKGPRWASVNL 46