BLASTX nr result
ID: Atractylodes21_contig00044711
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00044711 (408 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512672.1| glycyl-tRNA synthetase, putative [Ricinus co... 79 3e-13 ref|XP_002893587.1| glycyl-tRNA synthetase [Arabidopsis lyrata s... 75 6e-12 ref|XP_002304639.1| predicted protein [Populus trichocarpa] gi|2... 75 6e-12 gb|AAK92832.1| putative glycyl tRNA synthetase [Arabidopsis thal... 75 7e-12 gb|AAM64494.1| glycyl tRNA synthetase, putative [Arabidopsis tha... 75 7e-12 >ref|XP_002512672.1| glycyl-tRNA synthetase, putative [Ricinus communis] gi|223548633|gb|EEF50124.1| glycyl-tRNA synthetase, putative [Ricinus communis] Length = 686 Score = 79.3 bits (194), Expect = 3e-13 Identities = 42/66 (63%), Positives = 51/66 (77%) Frame = -1 Query: 198 WINLNLSRGRVGSNFSFPWAMNEKEAMDMKGALESKGVVEFEVCTLEKMVTLKKNMVSIS 19 W+ NL+R + +AMNEKEAM+MK +LE+KG VEF VCTLEK VT+KKNMV+IS Sbjct: 459 WLLKNLTRMLI---LHCKFAMNEKEAMEMKASLETKGEVEFYVCTLEKNVTIKKNMVTIS 515 Query: 18 KEKKKE 1 KEKKKE Sbjct: 516 KEKKKE 521 >ref|XP_002893587.1| glycyl-tRNA synthetase [Arabidopsis lyrata subsp. lyrata] gi|297339429|gb|EFH69846.1| glycyl-tRNA synthetase [Arabidopsis lyrata subsp. lyrata] Length = 730 Score = 75.1 bits (183), Expect = 6e-12 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = -1 Query: 141 AMNEKEAMDMKGALESKGVVEFEVCTLEKMVTLKKNMVSISKEKKKE 1 AMNE+EAM+MK +LESKG VEF VCTL K V++KKNMVSISKEKKKE Sbjct: 519 AMNEEEAMEMKASLESKGEVEFYVCTLNKTVSIKKNMVSISKEKKKE 565 >ref|XP_002304639.1| predicted protein [Populus trichocarpa] gi|222842071|gb|EEE79618.1| predicted protein [Populus trichocarpa] Length = 691 Score = 75.1 bits (183), Expect = 6e-12 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = -1 Query: 141 AMNEKEAMDMKGALESKGVVEFEVCTLEKMVTLKKNMVSISKEKKKE 1 AMNEKEA+DMK +LE+KG VEF VCTL + VT+KKNMVSISKEKKKE Sbjct: 480 AMNEKEALDMKASLETKGEVEFYVCTLGEKVTIKKNMVSISKEKKKE 526 >gb|AAK92832.1| putative glycyl tRNA synthetase [Arabidopsis thaliana] Length = 729 Score = 74.7 bits (182), Expect = 7e-12 Identities = 37/47 (78%), Positives = 41/47 (87%) Frame = -1 Query: 141 AMNEKEAMDMKGALESKGVVEFEVCTLEKMVTLKKNMVSISKEKKKE 1 AMNE+EAM+MK LESKG VEF VCTL+K V +KKNMVSISKEKKKE Sbjct: 518 AMNEEEAMEMKATLESKGEVEFYVCTLKKSVNIKKNMVSISKEKKKE 564 >gb|AAM64494.1| glycyl tRNA synthetase, putative [Arabidopsis thaliana] Length = 690 Score = 74.7 bits (182), Expect = 7e-12 Identities = 37/47 (78%), Positives = 41/47 (87%) Frame = -1 Query: 141 AMNEKEAMDMKGALESKGVVEFEVCTLEKMVTLKKNMVSISKEKKKE 1 AMNE+EAM+MK LESKG VEF VCTL+K V +KKNMVSISKEKKKE Sbjct: 479 AMNEEEAMEMKATLESKGEVEFYVCTLKKSVNIKKNMVSISKEKKKE 525