BLASTX nr result
ID: Atractylodes21_contig00044636
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00044636 (341 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_003208050.1| putative polyprotein [Pelargonium vein bandi... 80 1e-13 ref|NP_041734.1| polyprotein [Cacao swollen shoot virus] gi|3478... 79 4e-13 emb|CAE76628.1| polyprotein [Cacao swollen shoot virus] 79 4e-13 emb|CAE81285.1| polyprotein [Cacao swollen shoot virus] 79 4e-13 emb|CAE81279.1| polyprotein [Cacao swollen shoot virus] 79 4e-13 >ref|YP_003208050.1| putative polyprotein [Pelargonium vein banding virus] gi|258547408|gb|ACV74337.1| putative polyprotein [Pelargonium vein banding virus] Length = 1970 Score = 80.5 bits (197), Expect = 1e-13 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +2 Query: 227 LPWTAFLVPGGLYEWLVMPFGLKNAPAIFQRKMDKCFK 340 +PWTAF VPGGLYEWLVMPFGLKNAP++FQRKMD CFK Sbjct: 1502 IPWTAFCVPGGLYEWLVMPFGLKNAPSVFQRKMDDCFK 1539 >ref|NP_041734.1| polyprotein [Cacao swollen shoot virus] gi|347871|gb|AAA03171.1| polyprotein [Cacao swollen shoot virus] Length = 1834 Score = 79.0 bits (193), Expect = 4e-13 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +2 Query: 227 LPWTAFLVPGGLYEWLVMPFGLKNAPAIFQRKMDKCFK 340 +PWTAF VP GLYEWLVMPFGLKNAPA+FQRKMD+CFK Sbjct: 1397 IPWTAFWVPQGLYEWLVMPFGLKNAPAVFQRKMDQCFK 1434 >emb|CAE76628.1| polyprotein [Cacao swollen shoot virus] Length = 1847 Score = 79.0 bits (193), Expect = 4e-13 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +2 Query: 227 LPWTAFLVPGGLYEWLVMPFGLKNAPAIFQRKMDKCFK 340 +PWTAF VP GLYEWLVMPFGLKNAPA+FQRKMD+CFK Sbjct: 1404 IPWTAFWVPQGLYEWLVMPFGLKNAPAVFQRKMDQCFK 1441 >emb|CAE81285.1| polyprotein [Cacao swollen shoot virus] Length = 1770 Score = 79.0 bits (193), Expect = 4e-13 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +2 Query: 227 LPWTAFLVPGGLYEWLVMPFGLKNAPAIFQRKMDKCFK 340 +PWTAF VP GLYEWLVMPFGLKNAPA+FQRKMD+CFK Sbjct: 1327 IPWTAFWVPQGLYEWLVMPFGLKNAPAVFQRKMDQCFK 1364 >emb|CAE81279.1| polyprotein [Cacao swollen shoot virus] Length = 1816 Score = 79.0 bits (193), Expect = 4e-13 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +2 Query: 227 LPWTAFLVPGGLYEWLVMPFGLKNAPAIFQRKMDKCFK 340 +PWTAF VP GLYEWLVMPFGLKNAPA+FQRKMD+CFK Sbjct: 1403 IPWTAFWVPQGLYEWLVMPFGLKNAPAVFQRKMDQCFK 1440