BLASTX nr result
ID: Atractylodes21_contig00044624
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00044624 (608 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABE01395.1| phragmoplastin [Camellia sinensis] 62 6e-08 ref|NP_191735.2| dynamin-related protein 1B [Arabidopsis thalian... 61 1e-07 ref|XP_003631401.1| PREDICTED: dynamin-related protein 5A [Vitis... 61 1e-07 ref|XP_003529888.1| PREDICTED: dynamin-related protein 5A-like [... 61 1e-07 ref|XP_003638678.1| Dynamin-related protein 1A [Medicago truncat... 61 1e-07 >gb|ABE01395.1| phragmoplastin [Camellia sinensis] Length = 609 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +1 Query: 502 GKDFLPCGSGIVTRRPLVLQLHRIEEGI*YAEFAH 606 GKDFLP GSGIVTRRPLVLQLHRI+EG YAEF H Sbjct: 56 GKDFLPRGSGIVTRRPLVLQLHRIDEGREYAEFMH 90 >ref|NP_191735.2| dynamin-related protein 1B [Arabidopsis thaliana] gi|68566305|sp|Q84XF3.1|DRP1B_ARATH RecName: Full=Dynamin-related protein 1B; AltName: Full=Dynamin-like protein B gi|27543504|gb|AAO16682.1| dynamin-like protein B [Arabidopsis thaliana] gi|332646732|gb|AEE80253.1| dynamin-related protein 1B [Arabidopsis thaliana] Length = 610 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +1 Query: 502 GKDFLPCGSGIVTRRPLVLQLHRIEEGI*YAEFAH 606 GKDFLP G+GIVTRRPLVLQLHRI+EG YAEF H Sbjct: 56 GKDFLPRGAGIVTRRPLVLQLHRIDEGKEYAEFMH 90 >ref|XP_003631401.1| PREDICTED: dynamin-related protein 5A [Vitis vinifera] Length = 603 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +1 Query: 502 GKDFLPCGSGIVTRRPLVLQLHRIEEGI*YAEFAH 606 GKDFLP GSGIVTRRPLVLQLH+I+EG YAEF H Sbjct: 56 GKDFLPRGSGIVTRRPLVLQLHKIDEGREYAEFLH 90 >ref|XP_003529888.1| PREDICTED: dynamin-related protein 5A-like [Glycine max] Length = 609 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +1 Query: 502 GKDFLPCGSGIVTRRPLVLQLHRIEEGI*YAEFAH 606 GKDFLP GSGIVTRRPLVLQLH+I+EG YAEF H Sbjct: 56 GKDFLPRGSGIVTRRPLVLQLHKIDEGREYAEFMH 90 >ref|XP_003638678.1| Dynamin-related protein 1A [Medicago truncatula] gi|355504613|gb|AES85816.1| Dynamin-related protein 1A [Medicago truncatula] Length = 607 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +1 Query: 502 GKDFLPCGSGIVTRRPLVLQLHRIEEGI*YAEFAH 606 GKDFLP GSGIVTRRPLVLQLH+I+EG YAEF H Sbjct: 56 GKDFLPRGSGIVTRRPLVLQLHKIDEGREYAEFMH 90