BLASTX nr result
ID: Atractylodes21_contig00044559
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00044559 (308 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001769221.1| predicted protein [Physcomitrella patens sub... 75 5e-12 gb|AAW79307.1| chloroplast cytochrome b6 [Acetabularia acetabulum] 74 1e-11 sp|Q69GY7.1|UCRIA_SOLTU RecName: Full=Cytochrome b6-f complex ir... 73 3e-11 ref|XP_002513246.1| Cytochrome b6-f complex iron-sulfur subunit,... 73 3e-11 gb|ABD73295.1| photosynthetic electron transfer-like protein [Pa... 73 3e-11 >ref|XP_001769221.1| predicted protein [Physcomitrella patens subsp. patens] gi|162679486|gb|EDQ65933.1| predicted protein [Physcomitrella patens subsp. patens] Length = 212 Score = 75.1 bits (183), Expect = 5e-12 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = +2 Query: 2 QGKVVRGPAPLSLALAHVDIEDERVVFDPWTETDFRTGD 118 QGKVVRGPAPLSLALAHVD+ D++VVF PWTETDFRTG+ Sbjct: 169 QGKVVRGPAPLSLALAHVDVVDDKVVFSPWTETDFRTGE 207 >gb|AAW79307.1| chloroplast cytochrome b6 [Acetabularia acetabulum] Length = 174 Score = 73.9 bits (180), Expect = 1e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +2 Query: 2 QGKVVRGPAPLSLALAHVDIEDERVVFDPWTETDFRTGD 118 QGKVVRGPAPLSLALAH DI+D+ VVF PWTETDFRTG+ Sbjct: 131 QGKVVRGPAPLSLALAHCDIQDDAVVFSPWTETDFRTGE 169 >sp|Q69GY7.1|UCRIA_SOLTU RecName: Full=Cytochrome b6-f complex iron-sulfur subunit, chloroplastic; AltName: Full=Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein; AltName: Full=Rieske iron-sulfur protein; Short=ISP; Short=RISP; Flags: Precursor gi|37222949|gb|AAQ90151.1| putative Rieske Fe-S protein precursor [Solanum tuberosum] Length = 230 Score = 72.8 bits (177), Expect = 3e-11 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = +2 Query: 2 QGKVVRGPAPLSLALAHVDIEDERVVFDPWTETDFRTGDA 121 QGKVVRGPAPLSLALAH DI+D +VVF PW ETDFRTGD+ Sbjct: 187 QGKVVRGPAPLSLALAHADIDDGKVVFVPWVETDFRTGDS 226 >ref|XP_002513246.1| Cytochrome b6-f complex iron-sulfur subunit, chloroplast precursor, putative [Ricinus communis] gi|223547620|gb|EEF49114.1| Cytochrome b6-f complex iron-sulfur subunit, chloroplast precursor, putative [Ricinus communis] Length = 220 Score = 72.8 bits (177), Expect = 3e-11 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = +2 Query: 2 QGKVVRGPAPLSLALAHVDIEDERVVFDPWTETDFRTGDA 121 QG+VVRGPAPLSLALAH DI+D +VVF PW ETDFRTGDA Sbjct: 177 QGRVVRGPAPLSLALAHADIDDGKVVFVPWVETDFRTGDA 216 >gb|ABD73295.1| photosynthetic electron transfer-like protein [Panax ginseng] Length = 184 Score = 72.8 bits (177), Expect = 3e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +2 Query: 2 QGKVVRGPAPLSLALAHVDIEDERVVFDPWTETDFRTGD 118 QGKVVRGPAPLSLALAH DI+D +VVF PWTETDFRTG+ Sbjct: 141 QGKVVRGPAPLSLALAHADIDDGKVVFVPWTETDFRTGE 179