BLASTX nr result
ID: Atractylodes21_contig00044525
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00044525 (355 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI29214.3| unnamed protein product [Vitis vinifera] 56 3e-06 ref|XP_002270503.1| PREDICTED: alkylated DNA repair protein alkB... 56 3e-06 ref|XP_002304398.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 ref|XP_003534335.1| PREDICTED: alkylated DNA repair protein alkB... 55 6e-06 >emb|CBI29214.3| unnamed protein product [Vitis vinifera] Length = 912 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -1 Query: 352 RGSRRVSFTFRKVRKGPCHCNYPQFCDSRR 263 RG RRVSFTFRKVR GPC C +PQ+CDS R Sbjct: 883 RGPRRVSFTFRKVRTGPCQCEFPQYCDSPR 912 >ref|XP_002270503.1| PREDICTED: alkylated DNA repair protein alkB homolog 8-like [Vitis vinifera] Length = 349 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -1 Query: 352 RGSRRVSFTFRKVRKGPCHCNYPQFCDSRR 263 RG RRVSFTFRKVR GPC C +PQ+CDS R Sbjct: 320 RGPRRVSFTFRKVRTGPCQCEFPQYCDSPR 349 >ref|XP_002304398.1| predicted protein [Populus trichocarpa] gi|222841830|gb|EEE79377.1| predicted protein [Populus trichocarpa] Length = 344 Score = 56.2 bits (134), Expect = 3e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -1 Query: 352 RGSRRVSFTFRKVRKGPCHCNYPQFCDSRR 263 RG+RRVSFTFRKV +GPC C +PQ+CDS R Sbjct: 315 RGARRVSFTFRKVLRGPCQCEFPQYCDSER 344 >ref|XP_003534335.1| PREDICTED: alkylated DNA repair protein alkB homolog 8-like [Glycine max] Length = 342 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -1 Query: 352 RGSRRVSFTFRKVRKGPCHCNYPQFCDSRR 263 R SRRVSFTFRKVR+G C C +PQ+CDSRR Sbjct: 313 RASRRVSFTFRKVREGLCKCEFPQYCDSRR 342