BLASTX nr result
ID: Atractylodes21_contig00044478
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00044478 (205 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003635161.1| PREDICTED: cysteine-rich receptor-like prote... 59 5e-07 ref|XP_002317275.1| predicted protein [Populus trichocarpa] gi|2... 57 1e-06 ref|XP_004155665.1| PREDICTED: cysteine-rich receptor-like prote... 57 2e-06 ref|XP_004134965.1| PREDICTED: cysteine-rich receptor-like prote... 57 2e-06 ref|XP_003635307.1| PREDICTED: uncharacterized protein LOC100265... 57 2e-06 >ref|XP_003635161.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like [Vitis vinifera] Length = 704 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/49 (57%), Positives = 33/49 (67%) Frame = +1 Query: 1 VDEALRWINIALLCIQRDPEARPTMSTVVFMLEGQWSANLPMPFEPLLS 147 V EA+RWI+IALLC+Q DP RP MS+V ML +W NLP P P S Sbjct: 641 VSEAVRWIHIALLCVQEDPNDRPPMSSVALMLGSKW-VNLPQPSAPPFS 688 >ref|XP_002317275.1| predicted protein [Populus trichocarpa] gi|222860340|gb|EEE97887.1| predicted protein [Populus trichocarpa] Length = 402 Score = 57.4 bits (137), Expect = 1e-06 Identities = 29/43 (67%), Positives = 32/43 (74%) Frame = +1 Query: 1 VDEALRWINIALLCIQRDPEARPTMSTVVFMLEGQWSANLPMP 129 V EALRWI+IALLC+Q DP RPTMS VV ML G + NLP P Sbjct: 322 VSEALRWIHIALLCVQDDPARRPTMSLVVLML-GSNAVNLPQP 363 >ref|XP_004155665.1| PREDICTED: cysteine-rich receptor-like protein kinase 8-like [Cucumis sativus] Length = 1230 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/46 (60%), Positives = 32/46 (69%) Frame = +1 Query: 1 VDEALRWINIALLCIQRDPEARPTMSTVVFMLEGQWSANLPMPFEP 138 + EALRWI I LLC+Q DP RPTMS VV ML G S +LP P +P Sbjct: 1152 LSEALRWIQIGLLCVQEDPNIRPTMSMVVLML-GSKSIHLPQPSKP 1196 >ref|XP_004134965.1| PREDICTED: cysteine-rich receptor-like protein kinase 8-like [Cucumis sativus] Length = 579 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/46 (60%), Positives = 32/46 (69%) Frame = +1 Query: 1 VDEALRWINIALLCIQRDPEARPTMSTVVFMLEGQWSANLPMPFEP 138 + EALRWI I LLC+Q DP RPTMS VV ML G S +LP P +P Sbjct: 501 LSEALRWIQIGLLCVQEDPNIRPTMSMVVLML-GSKSIHLPQPSKP 545 >ref|XP_003635307.1| PREDICTED: uncharacterized protein LOC100265431, partial [Vitis vinifera] Length = 1453 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/49 (59%), Positives = 33/49 (67%) Frame = +1 Query: 1 VDEALRWINIALLCIQRDPEARPTMSTVVFMLEGQWSANLPMPFEPLLS 147 V EALRWI+IALLC+Q +P RP MS+V ML G S NLP P P S Sbjct: 611 VSEALRWIHIALLCVQEEPNDRPLMSSVALML-GSKSVNLPQPSAPPFS 658