BLASTX nr result
ID: Atractylodes21_contig00044407
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00044407 (297 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004138606.1| PREDICTED: TBC1 domain family member 2A-like... 73 2e-11 ref|NP_566323.1| RabGAP/TBC domain-containing protein [Arabidops... 70 2e-10 ref|XP_002884671.1| RabGAP/TBC domain-containing protein [Arabid... 70 2e-10 ref|XP_002266264.1| PREDICTED: TBC1 domain family member 2A [Vit... 65 4e-09 ref|XP_003618023.1| TBC1 domain family member 2B [Medicago trunc... 65 8e-09 >ref|XP_004138606.1| PREDICTED: TBC1 domain family member 2A-like [Cucumis sativus] gi|449490052|ref|XP_004158494.1| PREDICTED: TBC1 domain family member 2A-like [Cucumis sativus] Length = 395 Score = 73.2 bits (178), Expect = 2e-11 Identities = 32/42 (76%), Positives = 40/42 (95%) Frame = +2 Query: 170 MYGTQSQRDLSLEIQSEVPISRPSIHARRAKITVKFQDLYGF 295 M+GTQS+RD++LE+Q+++PI RPSIHARRA ITVKFQDLYGF Sbjct: 1 MFGTQSKRDIALELQAQIPILRPSIHARRANITVKFQDLYGF 42 >ref|NP_566323.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana] gi|145332002|ref|NP_001078123.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana] gi|98960973|gb|ABF58970.1| At3g07890 [Arabidopsis thaliana] gi|110737642|dbj|BAF00761.1| putative GTPase activator protein [Arabidopsis thaliana] gi|332641094|gb|AEE74615.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana] gi|332641095|gb|AEE74616.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana] Length = 400 Score = 70.1 bits (170), Expect = 2e-10 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = +2 Query: 170 MYGTQSQRDLSLEIQSEVPISRPSIHARRAKITVKFQDLYGF 295 M+G QS+RDL++E+QS++PI RPSIHARRA I VKFQDLYGF Sbjct: 1 MFGIQSRRDLTMELQSQIPILRPSIHARRANIVVKFQDLYGF 42 >ref|XP_002884671.1| RabGAP/TBC domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297330511|gb|EFH60930.1| RabGAP/TBC domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 400 Score = 70.1 bits (170), Expect = 2e-10 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = +2 Query: 170 MYGTQSQRDLSLEIQSEVPISRPSIHARRAKITVKFQDLYGF 295 M+G QS+RDL++E+QS++PI RPSIHARRA I VKFQDLYGF Sbjct: 1 MFGIQSRRDLTMELQSQIPILRPSIHARRANIVVKFQDLYGF 42 >ref|XP_002266264.1| PREDICTED: TBC1 domain family member 2A [Vitis vinifera] gi|297739137|emb|CBI28788.3| unnamed protein product [Vitis vinifera] Length = 398 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +2 Query: 170 MYGTQSQRDLSLEIQSEVPISRPSIHARRAKITVKFQDLYGF 295 M+GTQS RD+S E QS++P RPSI+ RRA ITVKFQDLYGF Sbjct: 1 MFGTQSTRDISFEFQSQIPNWRPSIYTRRANITVKFQDLYGF 42 >ref|XP_003618023.1| TBC1 domain family member 2B [Medicago truncatula] gi|355519358|gb|AET00982.1| TBC1 domain family member 2B [Medicago truncatula] Length = 395 Score = 64.7 bits (156), Expect = 8e-09 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = +2 Query: 170 MYGTQSQRDLSLEIQSEVPISRPSIHARRAKITVKFQDLYGF 295 MYGT+S+ DL+ E QS++ + RPSIH+RRA ITVKFQDLYGF Sbjct: 1 MYGTKSKIDLAFEYQSQISVLRPSIHSRRANITVKFQDLYGF 42