BLASTX nr result
ID: Atractylodes21_contig00044148
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00044148 (376 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004153884.1| PREDICTED: enzymatic polyprotein-like, parti... 44 8e-07 ref|XP_004161395.1| PREDICTED: enzymatic polyprotein-like [Cucum... 41 6e-06 >ref|XP_004153884.1| PREDICTED: enzymatic polyprotein-like, partial [Cucumis sativus] Length = 564 Score = 44.3 bits (103), Expect(2) = 8e-07 Identities = 20/32 (62%), Positives = 23/32 (71%) Frame = -1 Query: 280 VFLQTRLKIGYHHICMKETDIQKTPF*THEGH 185 VF + LK GYH I MKE D++KT F THEGH Sbjct: 529 VFSKLDLKSGYHQIRMKEEDVEKTAFRTHEGH 560 Score = 33.5 bits (75), Expect(2) = 8e-07 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -3 Query: 335 DRFPTPIIYELLDELHEASV 276 D+FP P+I ELLDELH A+V Sbjct: 510 DKFPIPVIEELLDELHGATV 529 >ref|XP_004161395.1| PREDICTED: enzymatic polyprotein-like [Cucumis sativus] Length = 740 Score = 41.2 bits (95), Expect(2) = 6e-06 Identities = 19/32 (59%), Positives = 22/32 (68%) Frame = -1 Query: 280 VFLQTRLKIGYHHICMKETDIQKTPF*THEGH 185 VF + LK GYH I M E DI+KT F TH+GH Sbjct: 629 VFSKLDLKSGYHQIRMNEEDIEKTAFRTHKGH 660 Score = 33.5 bits (75), Expect(2) = 6e-06 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -3 Query: 335 DRFPTPIIYELLDELHEASV 276 D+FP P+I ELLDELH A+V Sbjct: 610 DKFPIPVIEELLDELHGATV 629