BLASTX nr result
ID: Atractylodes21_contig00043927
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00043927 (305 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269694.1| PREDICTED: pentatricopeptide repeat-containi... 57 1e-06 >ref|XP_002269694.1| PREDICTED: pentatricopeptide repeat-containing protein At2g02980 [Vitis vinifera] gi|296086362|emb|CBI31951.3| unnamed protein product [Vitis vinifera] Length = 595 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/47 (55%), Positives = 35/47 (74%) Frame = +2 Query: 155 PNRSPTKIPRKLTGTANPLSLLSKCTSLKEIKQIQAYFIKTHLHNDM 295 P +P P + T +PLSLL KCTSL+E+KQ+QA+ IKTHLH+D+ Sbjct: 6 PPVTPMCPPNSNSNTTHPLSLLPKCTSLRELKQLQAFAIKTHLHSDL 52