BLASTX nr result
ID: Atractylodes21_contig00043825
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00043825 (604 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003544733.1| PREDICTED: transcriptional corepressor SEUSS... 55 7e-06 >ref|XP_003544733.1| PREDICTED: transcriptional corepressor SEUSS-like [Glycine max] Length = 915 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/57 (50%), Positives = 31/57 (54%) Frame = -2 Query: 174 MVPPGPPTPLGGAQPVPXXXXXXXXXXXXXXXXXXXXXXXXXSLVSQRTQFNNMNML 4 MVPPGPPTP+GGAQPVP SLV+QR QFNNMNML Sbjct: 1 MVPPGPPTPIGGAQPVPPSLLRSNSGMLGGQGGPVPSQTSFPSLVAQRNQFNNMNML 57