BLASTX nr result
ID: Atractylodes21_contig00043322
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00043322 (360 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAY16669.1| ribulose-1,5-bisphosphate carboxylase/oxygenase l... 49 7e-08 emb|CAB02230.1| ribulose-1,5-bisphosphate carboxylase/oxygenase ... 46 1e-07 gb|ACA84025.1| ribulose-1,5-bisphosphate carboxylase/oxygenase l... 48 2e-07 gb|AEK34201.1| ribulose-1,5-bisphosphate carboxylase/oxygenase l... 48 2e-07 gb|AAC35087.1| ribulose-1,5-bisphosphate carboxylase/oxygenase [... 48 2e-07 >gb|AAY16669.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Pachystroma longifolium] Length = 465 Score = 49.3 bits (116), Expect(2) = 7e-08 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = +3 Query: 219 GTRK*MMKRRVFARELRVPVAMHDYLTEGF 308 GT + MMKR VFARELRVP+ MHDYLT GF Sbjct: 235 GTCEEMMKRAVFARELRVPIVMHDYLTGGF 264 Score = 32.0 bits (71), Expect(2) = 7e-08 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = +1 Query: 313 FPANSSLAHYCQDNG 357 F AN+SLAHYC+DNG Sbjct: 264 FTANTSLAHYCRDNG 278 >emb|CAB02230.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Foetidia asymetrica] Length = 459 Score = 45.8 bits (107), Expect(2) = 1e-07 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = +3 Query: 219 GTRK*MMKRRVFARELRVPVAMHDYLTEGF 308 GT + M+KR VFAREL VP+ MHDYLT GF Sbjct: 236 GTSEEMIKRAVFARELGVPIVMHDYLTGGF 265 Score = 35.0 bits (79), Expect(2) = 1e-07 Identities = 13/15 (86%), Positives = 15/15 (100%) Frame = +1 Query: 313 FPANSSLAHYCQDNG 357 FPAN+SLAHYC+DNG Sbjct: 265 FPANTSLAHYCRDNG 279 >gb|ACA84025.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Hedyosmum spectabile] gi|347547009|gb|AEP03558.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Hedyosmum spectabile] Length = 465 Score = 48.1 bits (113), Expect(2) = 2e-07 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +3 Query: 219 GTRK*MMKRRVFARELRVPVAMHDYLTEGF 308 GT K MMKR VFAREL VP+ MHDYLT GF Sbjct: 235 GTCKEMMKRAVFARELGVPIVMHDYLTGGF 264 Score = 32.0 bits (71), Expect(2) = 2e-07 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = +1 Query: 313 FPANSSLAHYCQDNG 357 F AN+SLAHYC+DNG Sbjct: 264 FTANTSLAHYCRDNG 278 >gb|AEK34201.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Lamium galeobdolon] Length = 453 Score = 48.1 bits (113), Expect(2) = 2e-07 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = +3 Query: 219 GTRK*MMKRRVFARELRVPVAMHDYLTEGF 308 GTR+ M+KR VFAREL VP+ MHDYLT GF Sbjct: 230 GTREEMIKRAVFARELGVPIVMHDYLTGGF 259 Score = 32.0 bits (71), Expect(2) = 2e-07 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = +1 Query: 313 FPANSSLAHYCQDNG 357 F AN+SLAHYC+DNG Sbjct: 259 FTANTSLAHYCRDNG 273 >gb|AAC35087.1| ribulose-1,5-bisphosphate carboxylase/oxygenase [Galeandra devoniana] Length = 447 Score = 48.1 bits (113), Expect(2) = 2e-07 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = +3 Query: 219 GTRK*MMKRRVFARELRVPVAMHDYLTEGF 308 GT + MMKR VFAREL VP+AMHDYLT GF Sbjct: 236 GTCEEMMKRAVFARELGVPIAMHDYLTGGF 265 Score = 32.0 bits (71), Expect(2) = 2e-07 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = +1 Query: 313 FPANSSLAHYCQDNG 357 F AN+SLAHYC+DNG Sbjct: 265 FTANTSLAHYCRDNG 279