BLASTX nr result
ID: Atractylodes21_contig00042938
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00042938 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_187470.1| ADP,ATP carrier protein 1 [Arabidopsis thaliana... 72 4e-11 ref|XP_002884685.1| adenosine nucleotide translocator [Arabidops... 72 4e-11 dbj|BAH20415.1| AT3G08580 [Arabidopsis thaliana] 72 4e-11 dbj|BAD94561.1| adenylate translocator [Arabidopsis thaliana] 72 4e-11 ref|XP_002871570.1| hypothetical protein ARALYDRAFT_488169 [Arab... 71 8e-11 >ref|NP_187470.1| ADP,ATP carrier protein 1 [Arabidopsis thaliana] gi|30680570|ref|NP_850541.1| ADP,ATP carrier protein 1 [Arabidopsis thaliana] gi|19883932|sp|P31167.2|ADT1_ARATH RecName: Full=ADP,ATP carrier protein 1, mitochondrial; AltName: Full=ADP/ATP translocase 1; AltName: Full=Adenine nucleotide translocator 1; Short=ANT 1; Flags: Precursor gi|12322734|gb|AAG51358.1|AC012562_19 adenylate translocator; 17953-16629 [Arabidopsis thaliana] gi|14334484|gb|AAK59440.1| putative adenylate translocator protein [Arabidopsis thaliana] gi|14596053|gb|AAK68754.1| adenylate translocator [Arabidopsis thaliana] gi|15809960|gb|AAL06907.1| AT3g08580/F17O14_5 [Arabidopsis thaliana] gi|18491189|gb|AAL69497.1| putative adenylate translocator protein [Arabidopsis thaliana] gi|23198346|gb|AAN15700.1| adenylate translocator [Arabidopsis thaliana] gi|27311563|gb|AAO00747.1| adenylate translocator [Arabidopsis thaliana] gi|110741939|dbj|BAE98910.1| adenylate translocator [Arabidopsis thaliana] gi|332641127|gb|AEE74648.1| ADP,ATP carrier protein 1 [Arabidopsis thaliana] gi|332641128|gb|AEE74649.1| ADP,ATP carrier protein 1 [Arabidopsis thaliana] Length = 381 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 293 GAGANILRAVAGAGVLSGYDKLQLLIFGKKYGSGGA 186 GAGANILRAVAGAGVLSGYDKLQL++FGKKYGSGGA Sbjct: 346 GAGANILRAVAGAGVLSGYDKLQLIVFGKKYGSGGA 381 >ref|XP_002884685.1| adenosine nucleotide translocator [Arabidopsis lyrata subsp. lyrata] gi|297330525|gb|EFH60944.1| adenosine nucleotide translocator [Arabidopsis lyrata subsp. lyrata] Length = 382 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 293 GAGANILRAVAGAGVLSGYDKLQLLIFGKKYGSGGA 186 GAGANILRAVAGAGVLSGYDKLQL++FGKKYGSGGA Sbjct: 347 GAGANILRAVAGAGVLSGYDKLQLIVFGKKYGSGGA 382 >dbj|BAH20415.1| AT3G08580 [Arabidopsis thaliana] Length = 206 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 293 GAGANILRAVAGAGVLSGYDKLQLLIFGKKYGSGGA 186 GAGANILRAVAGAGVLSGYDKLQL++FGKKYGSGGA Sbjct: 171 GAGANILRAVAGAGVLSGYDKLQLIVFGKKYGSGGA 206 >dbj|BAD94561.1| adenylate translocator [Arabidopsis thaliana] Length = 64 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 293 GAGANILRAVAGAGVLSGYDKLQLLIFGKKYGSGGA 186 GAGANILRAVAGAGVLSGYDKLQL++FGKKYGSGGA Sbjct: 29 GAGANILRAVAGAGVLSGYDKLQLIVFGKKYGSGGA 64 >ref|XP_002871570.1| hypothetical protein ARALYDRAFT_488169 [Arabidopsis lyrata subsp. lyrata] gi|297317407|gb|EFH47829.1| hypothetical protein ARALYDRAFT_488169 [Arabidopsis lyrata subsp. lyrata] Length = 384 Score = 71.2 bits (173), Expect = 8e-11 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -3 Query: 293 GAGANILRAVAGAGVLSGYDKLQLLIFGKKYGSGGA 186 GAGANILRAVAGAGVL+GYDKLQL++FGKKYGSGGA Sbjct: 349 GAGANILRAVAGAGVLAGYDKLQLIVFGKKYGSGGA 384