BLASTX nr result
ID: Atractylodes21_contig00042611
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00042611 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263905.1| PREDICTED: RING-H2 finger protein ATL1-like ... 57 2e-06 >ref|XP_002263905.1| PREDICTED: RING-H2 finger protein ATL1-like [Vitis vinifera] Length = 351 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/58 (48%), Positives = 37/58 (63%), Gaps = 11/58 (18%) Frame = +2 Query: 2 DSAVDRHIYLSVQDIIRNNEEA-----------NRTKRPFFSFGHTRGSRSAILPLEF 142 DSA D +Y++VQ+IIRN +R +R FFSFGH RGSR+A+LP+EF Sbjct: 292 DSAADPQLYMTVQEIIRNKNRPLSEVSTSQECDSRVRRSFFSFGHGRGSRNAVLPIEF 349