BLASTX nr result
ID: Atractylodes21_contig00042574
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00042574 (269 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004150671.1| PREDICTED: phosphatidylserine synthase 2-lik... 59 3e-07 >ref|XP_004150671.1| PREDICTED: phosphatidylserine synthase 2-like [Cucumis sativus] gi|449519402|ref|XP_004166724.1| PREDICTED: phosphatidylserine synthase 2-like [Cucumis sativus] Length = 428 Score = 59.3 bits (142), Expect = 3e-07 Identities = 23/43 (53%), Positives = 33/43 (76%) Frame = +1 Query: 139 MEPDGPKSRRRKDYAAQQSRAVSTLISDDELDPWTAWAYKPRT 267 MEPDGP+ R+++Y Q++ ++L ++LDPWTAWAYKPRT Sbjct: 3 MEPDGPRRARKRNYLVQENGDYNSLSMGEDLDPWTAWAYKPRT 45