BLASTX nr result
ID: Atractylodes21_contig00042287
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00042287 (296 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_068728.1| putative coat protein [Soybean chlorotic mottle... 94 1e-17 gb|AEE01491.1| coat protein [Blueberry red ringspot virus] 91 8e-17 ref|NP_395468.1| putative coat protein [Blueberry red ringspot v... 91 1e-16 ref|NP_861409.1| putative capsid protein [Cestrum yellow leaf cu... 90 2e-16 gb|AEQ49588.1| coat protein [Blueberry red ringspot virus] 88 6e-16 >ref|NP_068728.1| putative coat protein [Soybean chlorotic mottle virus] gi|18266819|sp|P15627.2|CAPSD_SOCMV RecName: Full=Capsid protein; Short=CP; AltName: Full=Coat protein gi|11322952|emb|CAC16944.1| putative coat protein [Soybean chlorotic mottle virus] Length = 441 Score = 94.0 bits (232), Expect = 1e-17 Identities = 48/98 (48%), Positives = 65/98 (66%), Gaps = 2/98 (2%) Frame = -2 Query: 292 KEAYKKNDRKYFRNRKQ--YKQKYRGNKQKYCPDKKKNCKCWLCQEEGHYANECPKKGRK 119 K+ KKN K+ RK+ +++K KQ+ CP KK C+CWLC EEGHYANECPKK K Sbjct: 343 KKYPKKNFWKWNNQRKKKTFRKKRPFRKQQTCPTGKKKCQCWLCHEEGHYANECPKKDNK 402 Query: 118 KETEILKVAYELGFDPLEDSDIDKDIEIYAYTYASESE 5 K + LK+ ++LGF+P+E SDI+ D E++ T SE Sbjct: 403 K-AQTLKLIFDLGFEPVE-SDIETDEELFELTSEDSSE 438 >gb|AEE01491.1| coat protein [Blueberry red ringspot virus] Length = 491 Score = 91.3 bits (225), Expect = 8e-17 Identities = 43/103 (41%), Positives = 70/103 (67%), Gaps = 5/103 (4%) Frame = -2 Query: 295 FKEAYKKNDRKYFRNRKQ--YKQKYRGNK--QKYCPDKKKNCKCWLCQEEGHYANECPKK 128 FK YKK + ++ + Q YKQ+Y NK QKYCP KK+CKCW+CQE+GHYANECP K Sbjct: 365 FKPWYKKKRYRMYKRKYQPKYKQRYWKNKSNQKYCPKGKKDCKCWICQEDGHYANECPNK 424 Query: 127 GRKKE-TEILKVAYELGFDPLEDSDIDKDIEIYAYTYASESEQ 2 ++++ ++L+ ++ +P+E+++I ++ E++ ESE+ Sbjct: 425 DKRRDKVKLLEQLSQVNLEPIENNEISEE-ELWYLQTDDESEE 466 >ref|NP_395468.1| putative coat protein [Blueberry red ringspot virus] gi|16033535|gb|AAL13273.1|AF404509_3 putative coat protein [Blueberry red ringspot virus] Length = 486 Score = 90.5 bits (223), Expect = 1e-16 Identities = 43/103 (41%), Positives = 69/103 (66%), Gaps = 5/103 (4%) Frame = -2 Query: 295 FKEAYKKNDRKYFRNRKQ--YKQKYRGNK--QKYCPDKKKNCKCWLCQEEGHYANECPKK 128 FK YKK + ++ + Q YKQ+Y NK QKYCP KK+CKCW+CQE+GHYANECP K Sbjct: 360 FKPWYKKKRYRMYKRKYQPKYKQRYWKNKSNQKYCPKGKKDCKCWICQEDGHYANECPNK 419 Query: 127 GRKKE-TEILKVAYELGFDPLEDSDIDKDIEIYAYTYASESEQ 2 ++++ ++L+ ++ +P+E+ +I ++ E++ ESE+ Sbjct: 420 DKRRDKVKLLEQLSQVNLEPIENDNISEE-ELWYLQTDEESEE 461 >ref|NP_861409.1| putative capsid protein [Cestrum yellow leaf curling virus] gi|81991105|sp|Q7TD09.1|CAPSD_CYLCV RecName: Full=Capsid protein; Short=CP; AltName: Full=coat protein gi|32305281|gb|AAP78923.1| putative capsid protein [Cestrum yellow leaf curling virus] Length = 501 Score = 90.1 bits (222), Expect = 2e-16 Identities = 46/101 (45%), Positives = 63/101 (62%), Gaps = 5/101 (4%) Frame = -2 Query: 289 EAYKKNDRKYFRNRKQYKQKYRGNKQKYCPDKKKNCKCWLCQEEGHYANECPKKGRKK-- 116 + +KK R + R K+K K+K+CP KK+CKCW+C EEGHYANECPKK ++K Sbjct: 396 DLWKKKKRFFKRRDFSKKKKENPGKKKFCPTGKKSCKCWICHEEGHYANECPKKTKEKHK 455 Query: 115 -ETEILKVAYELGFDPLED--SDIDKDIEIYAYTYASESEQ 2 + ++L A E GF+PLE SDI++ EI S SE+ Sbjct: 456 DKVKLLMEAEEEGFEPLESEASDIEEIFEIVEEDSESSSEE 496 >gb|AEQ49588.1| coat protein [Blueberry red ringspot virus] Length = 484 Score = 88.2 bits (217), Expect = 6e-16 Identities = 43/103 (41%), Positives = 67/103 (65%), Gaps = 5/103 (4%) Frame = -2 Query: 295 FKEAYKKNDRKYFRNRKQ--YKQKYRGNK--QKYCPDKKKNCKCWLCQEEGHYANECPKK 128 FK YKK + ++ + Q Y+Q+Y NK QKYCP KK CKCW+CQE+GHYANECP K Sbjct: 358 FKPWYKKRRYRMYKRKYQPKYRQRYWKNKSTQKYCPKGKKECKCWICQEDGHYANECPNK 417 Query: 127 GRKKE-TEILKVAYELGFDPLEDSDIDKDIEIYAYTYASESEQ 2 ++++ ++L+ ++ +P+E +DI + E++ ESE+ Sbjct: 418 DKRRDKVKLLEQLSQVNLEPIE-NDIISEEELWYLQTDEESEE 459