BLASTX nr result
ID: Atractylodes21_contig00042214
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00042214 (317 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN61034.1| hypothetical protein VITISV_041749 [Vitis vinifera] 72 3e-13 emb|CAN65339.1| hypothetical protein VITISV_038404 [Vitis vinifera] 68 4e-13 emb|CAN61245.1| hypothetical protein VITISV_007013 [Vitis vinifera] 63 6e-12 emb|CAN81492.1| hypothetical protein VITISV_019989 [Vitis vinifera] 63 1e-11 emb|CAN74369.1| hypothetical protein VITISV_037867 [Vitis vinifera] 62 3e-11 >emb|CAN61034.1| hypothetical protein VITISV_041749 [Vitis vinifera] Length = 434 Score = 72.4 bits (176), Expect(2) = 3e-13 Identities = 33/55 (60%), Positives = 42/55 (76%) Frame = +1 Query: 1 AMAKEGIFVSQRKYVLDRLSETDMSGCKLVETPMDPNVKLMPRTEELAAHKGQYQ 165 A +KEGIFV+QRKYVLD L +T GCKLVETP++PN+KL+P ++ K QYQ Sbjct: 263 ARSKEGIFVNQRKYVLDLLGDTGQLGCKLVETPIEPNIKLLPSKDDEVKDKEQYQ 317 Score = 27.3 bits (59), Expect(2) = 3e-13 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = +3 Query: 168 LVEKLIYLTHTCPNISFVMQ 227 LV +LIYL+H C +I+F ++ Sbjct: 319 LVRRLIYLSHACSDIAFSIE 338 >emb|CAN65339.1| hypothetical protein VITISV_038404 [Vitis vinifera] Length = 313 Score = 67.8 bits (164), Expect(2) = 4e-13 Identities = 31/53 (58%), Positives = 39/53 (73%) Frame = +1 Query: 7 AKEGIFVSQRKYVLDRLSETDMSGCKLVETPMDPNVKLMPRTEELAAHKGQYQ 165 +KEGIFV+QRKYVLD L ET GCKL ETP++ N+KL+P ++ K QYQ Sbjct: 86 SKEGIFVNQRKYVLDLLGETGQLGCKLAETPIESNIKLLPSKDDEVKDKEQYQ 138 Score = 31.6 bits (70), Expect(2) = 4e-13 Identities = 12/19 (63%), Positives = 17/19 (89%) Frame = +3 Query: 168 LVEKLIYLTHTCPNISFVM 224 LV +LIYL+HTCP+I+F + Sbjct: 140 LVGRLIYLSHTCPDIAFAV 158 >emb|CAN61245.1| hypothetical protein VITISV_007013 [Vitis vinifera] Length = 632 Score = 63.2 bits (152), Expect(2) = 6e-12 Identities = 31/55 (56%), Positives = 38/55 (69%) Frame = +1 Query: 1 AMAKEGIFVSQRKYVLDRLSETDMSGCKLVETPMDPNVKLMPRTEELAAHKGQYQ 165 A +KEGI V+QRKYVLD L ET M GCK VETP++ NVKL P + + +YQ Sbjct: 419 ARSKEGILVNQRKYVLDLLDETGMLGCKXVETPIELNVKLQPTKAKNVKDRDRYQ 473 Score = 32.0 bits (71), Expect(2) = 6e-12 Identities = 12/19 (63%), Positives = 18/19 (94%) Frame = +3 Query: 168 LVEKLIYLTHTCPNISFVM 224 LV +LIYL+HTCP+I+F++ Sbjct: 475 LVGRLIYLSHTCPDIAFLV 493 >emb|CAN81492.1| hypothetical protein VITISV_019989 [Vitis vinifera] Length = 769 Score = 63.2 bits (152), Expect(2) = 1e-11 Identities = 30/53 (56%), Positives = 37/53 (69%) Frame = +1 Query: 7 AKEGIFVSQRKYVLDRLSETDMSGCKLVETPMDPNVKLMPRTEELAAHKGQYQ 165 +KEGIFV+QRKYVLD L ET M GCK ETP++PNVK P + + +YQ Sbjct: 588 SKEGIFVNQRKYVLDLLDETGMLGCKSAETPIEPNVKPQPTKAKNMKDRDRYQ 640 Score = 31.2 bits (69), Expect(2) = 1e-11 Identities = 12/17 (70%), Positives = 16/17 (94%) Frame = +3 Query: 168 LVEKLIYLTHTCPNISF 218 LV +LIYL+HTCP+I+F Sbjct: 642 LVGRLIYLSHTCPDIAF 658 >emb|CAN74369.1| hypothetical protein VITISV_037867 [Vitis vinifera] Length = 896 Score = 61.6 bits (148), Expect(2) = 3e-11 Identities = 30/53 (56%), Positives = 36/53 (67%) Frame = +1 Query: 7 AKEGIFVSQRKYVLDRLSETDMSGCKLVETPMDPNVKLMPRTEELAAHKGQYQ 165 +KEGIFV+QRKYVLD L ET M GCK ETP++ NVKL P + + YQ Sbjct: 510 SKEGIFVNQRKYVLDLLDETGMLGCKSAETPIELNVKLRPTKAKNVKDRDHYQ 562 Score = 31.2 bits (69), Expect(2) = 3e-11 Identities = 12/17 (70%), Positives = 16/17 (94%) Frame = +3 Query: 168 LVEKLIYLTHTCPNISF 218 LV +LIYL+HTCP+I+F Sbjct: 564 LVGRLIYLSHTCPDIAF 580