BLASTX nr result
ID: Atractylodes21_contig00042124
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00042124 (354 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002536345.1| conserved hypothetical protein [Ricinus comm... 91 7e-17 ref|XP_003588351.1| Maturase [Medicago truncatula] gi|355477399|... 87 2e-15 ref|XP_002489092.1| hypothetical protein SORBIDRAFT_0088s002240 ... 70 3e-11 ref|XP_002535070.1| conserved hypothetical protein [Ricinus comm... 71 1e-10 >ref|XP_002536345.1| conserved hypothetical protein [Ricinus communis] gi|223520024|gb|EEF26037.1| conserved hypothetical protein [Ricinus communis] Length = 99 Score = 91.3 bits (225), Expect = 7e-17 Identities = 41/42 (97%), Positives = 41/42 (97%) Frame = -1 Query: 126 RKANCLLAGSCMSGNVHVRLREKGGGQKWPCCTSLSSSMGSA 1 RKANCLLAGSCMSGNVHVR REKGGGQKWPCCTSLSSSMGSA Sbjct: 1 RKANCLLAGSCMSGNVHVRFREKGGGQKWPCCTSLSSSMGSA 42 >ref|XP_003588351.1| Maturase [Medicago truncatula] gi|355477399|gb|AES58602.1| Maturase [Medicago truncatula] Length = 996 Score = 86.7 bits (213), Expect = 2e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -1 Query: 126 RKANCLLAGSCMSGNVHVRLREKGGGQKWPCCTSLSSSMGSA 1 R+A+CL AGSCMSGNVHVRLREKGGGQKWPCCTSLSSSMGSA Sbjct: 24 READCLPAGSCMSGNVHVRLREKGGGQKWPCCTSLSSSMGSA 65 >ref|XP_002489092.1| hypothetical protein SORBIDRAFT_0088s002240 [Sorghum bicolor] gi|241947412|gb|EES20557.1| hypothetical protein SORBIDRAFT_0088s002240 [Sorghum bicolor] Length = 58 Score = 70.5 bits (171), Expect(2) = 3e-11 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +1 Query: 46 LSTALLTEPYVDVTAHTAPSQQAVSLPLQGMEVWVNRHQ 162 +S LLTEPYVDVTAHTAPSQQAVS PL+ MEVW+NRHQ Sbjct: 6 ISVHLLTEPYVDVTAHTAPSQQAVSFPLEVMEVWINRHQ 44 Score = 22.7 bits (47), Expect(2) = 3e-11 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 27 RYNKAISVH 53 RYNKAISVH Sbjct: 1 RYNKAISVH 9 >ref|XP_002535070.1| conserved hypothetical protein [Ricinus communis] gi|223524097|gb|EEF27311.1| conserved hypothetical protein [Ricinus communis] Length = 93 Score = 70.9 bits (172), Expect = 1e-10 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 126 RKANCLLAGSCMSGNVHVRLREKGGGQKWPC 34 RKANCLLAGSCMSGNVHVR REKGGGQKWPC Sbjct: 63 RKANCLLAGSCMSGNVHVRFREKGGGQKWPC 93