BLASTX nr result
ID: Atractylodes21_contig00042070
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00042070 (317 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001109553.1| hypothetical protein Poptr_cp075 [Populus tr... 75 6e-12 >ref|YP_001109553.1| hypothetical protein Poptr_cp075 [Populus trichocarpa] gi|134093265|ref|YP_001109566.1| hypothetical protein Poptr_cp088 [Populus trichocarpa] gi|133712114|gb|ABO36757.1| hypothetical protein Poptr_cp075 [Populus trichocarpa] gi|133712127|gb|ABO36770.1| hypothetical protein Poptr_cp088 [Populus trichocarpa] Length = 86 Score = 75.1 bits (183), Expect = 6e-12 Identities = 37/59 (62%), Positives = 41/59 (69%), Gaps = 4/59 (6%) Frame = -3 Query: 165 GSSTPRTPEYQTMNEERHDIR----YDSEAPILEEEGTKGLCSSIPWIDREGGQSFWFF 1 GSSTPRTPEY+TMNEERH+ + L TKGLC SI WIDREGG+SFWFF Sbjct: 5 GSSTPRTPEYRTMNEERHERKAYWLVIVRPQFLTGGDTKGLCPSITWIDREGGRSFWFF 63