BLASTX nr result
ID: Atractylodes21_contig00041882
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00041882 (283 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN69836.1| hypothetical protein VITISV_026000 [Vitis vinifera] 46 2e-09 emb|CAN73102.1| hypothetical protein VITISV_042891 [Vitis vinifera] 43 2e-08 emb|CAN61993.1| hypothetical protein VITISV_030446 [Vitis vinifera] 44 9e-08 emb|CAN81440.1| hypothetical protein VITISV_036850 [Vitis vinifera] 45 9e-08 emb|CAN65522.1| hypothetical protein VITISV_031371 [Vitis vinifera] 40 1e-07 >emb|CAN69836.1| hypothetical protein VITISV_026000 [Vitis vinifera] Length = 1263 Score = 46.2 bits (108), Expect(3) = 2e-09 Identities = 22/32 (68%), Positives = 24/32 (75%) Frame = +3 Query: 21 TIYKIDYS*TFIPVVKLNLIQVLLPLDVNLDW 116 T Y IDY+ TF PV KLN+IQVLL L NLDW Sbjct: 843 TTYGIDYTETFAPVAKLNIIQVLLSLASNLDW 874 Score = 33.5 bits (75), Expect(3) = 2e-09 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = +2 Query: 116 VHKVDIKNAFLNRDLDEEATWMFP 187 +H+ DIKNAFLN +L+EE M P Sbjct: 876 LHQFDIKNAFLNGELEEEVFMMLP 899 Score = 26.2 bits (56), Expect(3) = 2e-09 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +1 Query: 172 YMDVPLGLKFRDNRER-CVN*ESL*GLQQLPWAWFER 279 +M +P G + R C +SL GL+Q P AWF+R Sbjct: 895 FMMLPPGFYKEEEETRVCKLKKSLYGLKQSPRAWFDR 931 >emb|CAN73102.1| hypothetical protein VITISV_042891 [Vitis vinifera] Length = 1493 Score = 42.7 bits (99), Expect(3) = 2e-08 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +3 Query: 27 YKIDYS*TFIPVVKLNLIQVLLPLDVNLDW 116 Y IDY+ TF PV KLN I+VLL L NLDW Sbjct: 1057 YGIDYTETFAPVAKLNTIRVLLSLAANLDW 1086 Score = 33.5 bits (75), Expect(3) = 2e-08 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = +2 Query: 116 VHKVDIKNAFLNRDLDEEATWMFP 187 +H+ DIKNAFLN +L+EE M P Sbjct: 1088 LHQFDIKNAFLNGELEEEVFMMLP 1111 Score = 25.8 bits (55), Expect(3) = 2e-08 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +1 Query: 172 YMDVPLGLKFRDNRER-CVN*ESL*GLQQLPWAWFER 279 +M +P G + R C +SL GL+Q P AWF+R Sbjct: 1107 FMMLPPGFCKEEEETRVCKLKKSLYGLKQSPRAWFDR 1143 >emb|CAN61993.1| hypothetical protein VITISV_030446 [Vitis vinifera] Length = 842 Score = 43.5 bits (101), Expect(3) = 9e-08 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +3 Query: 27 YKIDYS*TFIPVVKLNLIQVLLPLDVNLDW 116 Y IDY+ TF PV KLN IQVLL L NLDW Sbjct: 307 YDIDYTETFAPVAKLNTIQVLLSLAGNLDW 336 Score = 30.0 bits (66), Expect(3) = 9e-08 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +2 Query: 116 VHKVDIKNAFLNRDLDEEATWMFP 187 +H+ DI NAFLN +L+EE + P Sbjct: 338 LHQFDINNAFLNGELEEEVFMILP 361 Score = 26.6 bits (57), Expect(3) = 9e-08 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +1 Query: 172 YMDVPLGLKFRDNRER-CVN*ESL*GLQQLPWAWFER 279 +M +P G + + R C +SL GL+Q P AWF+R Sbjct: 357 FMILPPGFCKEEEKTRVCKLKKSLYGLKQSPRAWFDR 393 >emb|CAN81440.1| hypothetical protein VITISV_036850 [Vitis vinifera] Length = 698 Score = 44.7 bits (104), Expect(3) = 9e-08 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = +3 Query: 27 YKIDYS*TFIPVVKLNLIQVLLPLDVNLDWC 119 Y IDY TF PV KLN I++LL L VN DWC Sbjct: 189 YGIDYQETFAPVAKLNTIRILLSLAVNQDWC 219 Score = 30.0 bits (66), Expect(3) = 9e-08 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +2 Query: 116 VHKVDIKNAFLNRDLDEEATWMFP 187 + ++DIKNAFLN DL+EE P Sbjct: 220 LQQLDIKNAFLNGDLEEEVYMEIP 243 Score = 25.4 bits (54), Expect(3) = 9e-08 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +1 Query: 172 YMDVPLGLKFRDNRERCVN*E-SL*GLQQLPWAWFER 279 YM++P G + + + + SL GL+Q P AWF+R Sbjct: 239 YMEIPPGFEESMAKNQVWKLQKSLYGLKQSPRAWFDR 275 >emb|CAN65522.1| hypothetical protein VITISV_031371 [Vitis vinifera] Length = 935 Score = 40.0 bits (92), Expect(3) = 1e-07 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +3 Query: 27 YKIDYS*TFIPVVKLNLIQVLLPLDVNLDW 116 Y IDY+ TF PV K N I+VLL L NL+W Sbjct: 646 YNIDYTETFAPVAKFNTIRVLLSLAANLNW 675 Score = 33.5 bits (75), Expect(3) = 1e-07 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = +2 Query: 116 VHKVDIKNAFLNRDLDEEATWMFP 187 +H+ DIKNAFLN +L+EE M P Sbjct: 677 LHQFDIKNAFLNGELEEEVFMMLP 700 Score = 26.2 bits (56), Expect(3) = 1e-07 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +1 Query: 172 YMDVPLGLKFRDNRER-CVN*ESL*GLQQLPWAWFER 279 +M +P G + R C +SL GL+Q P AWF+R Sbjct: 696 FMMLPPGFCKEEEETRVCKLKKSLYGLEQSPRAWFDR 732