BLASTX nr result
ID: Atractylodes21_contig00041563
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00041563 (289 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFR46577.1| xyloglucan endotransglucosylase/hydrolase 8, part... 73 3e-11 dbj|BAJ10423.1| xyloglucan endotransglucosylase/hydrolase [Diant... 71 8e-11 gb|ABE73119.1| endo-transglycosylase [Dianthus caryophyllus] 71 8e-11 ref|XP_002532673.1| Xyloglucan endotransglucosylase/hydrolase pr... 70 2e-10 dbj|BAJ10395.1| xyloglucan endotransglucosylase/hydrolase [Diant... 69 3e-10 >gb|AFR46577.1| xyloglucan endotransglucosylase/hydrolase 8, partial [Rosa x borboniana] Length = 192 Score = 72.8 bits (177), Expect = 3e-11 Identities = 32/51 (62%), Positives = 39/51 (76%) Frame = -3 Query: 281 TSWSSCSREPWITESLNNPGVEKMKSVQKKYMIYNYCNDAKRFPQGLPIEC 129 +S SS S+E W T+SL+ G E++ VQK YMIYNYC D KRFPQGLP+EC Sbjct: 138 SSPSSSSKEAWFTQSLDATGKERINWVQKNYMIYNYCKDTKRFPQGLPLEC 188 >dbj|BAJ10423.1| xyloglucan endotransglucosylase/hydrolase [Dianthus caryophyllus] Length = 281 Score = 71.2 bits (173), Expect = 8e-11 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = -3 Query: 269 SCSREPWITESLNNPGVEKMKSVQKKYMIYNYCNDAKRFPQGLPIEC 129 S SR W+TE L++ G+E+MK VQK YM+YNYC D +RFPQGLP EC Sbjct: 231 SRSRSNWLTEELDSAGLERMKWVQKNYMVYNYCADVQRFPQGLPTEC 277 >gb|ABE73119.1| endo-transglycosylase [Dianthus caryophyllus] Length = 186 Score = 71.2 bits (173), Expect = 8e-11 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = -3 Query: 269 SCSREPWITESLNNPGVEKMKSVQKKYMIYNYCNDAKRFPQGLPIEC 129 S SR W+TE L++ G+E+MK VQK YM+YNYC D +RFPQGLP EC Sbjct: 136 SRSRSNWLTEELDSAGLERMKWVQKNYMVYNYCADVQRFPQGLPTEC 182 >ref|XP_002532673.1| Xyloglucan endotransglucosylase/hydrolase protein 22 precursor, putative [Ricinus communis] gi|223527586|gb|EEF29701.1| Xyloglucan endotransglucosylase/hydrolase protein 22 precursor, putative [Ricinus communis] Length = 258 Score = 69.7 bits (169), Expect = 2e-10 Identities = 31/51 (60%), Positives = 38/51 (74%) Frame = -3 Query: 281 TSWSSCSREPWITESLNNPGVEKMKSVQKKYMIYNYCNDAKRFPQGLPIEC 129 +S SS S PW+T+SL+ G ++K VQ+ YMIYNYC D KRFPQGLP EC Sbjct: 205 SSNSSSSDNPWLTQSLDTTGHARIKWVQQNYMIYNYCTDTKRFPQGLPPEC 255 >dbj|BAJ10395.1| xyloglucan endotransglucosylase/hydrolase [Dianthus caryophyllus] Length = 289 Score = 69.3 bits (168), Expect = 3e-10 Identities = 29/48 (60%), Positives = 37/48 (77%) Frame = -3 Query: 272 SSCSREPWITESLNNPGVEKMKSVQKKYMIYNYCNDAKRFPQGLPIEC 129 +S SR W+TE L++ +E+MK VQK YM+YNYC D +RFPQGLP EC Sbjct: 238 TSVSRSNWLTEELDSTRLERMKWVQKNYMVYNYCADVQRFPQGLPTEC 285