BLASTX nr result
ID: Atractylodes21_contig00041401
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00041401 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002305008.1| predicted protein [Populus trichocarpa] gi|2... 62 6e-08 ref|XP_003593490.1| hypothetical protein MTR_2g012750 [Medicago ... 55 5e-06 >ref|XP_002305008.1| predicted protein [Populus trichocarpa] gi|222847972|gb|EEE85519.1| predicted protein [Populus trichocarpa] Length = 316 Score = 61.6 bits (148), Expect = 6e-08 Identities = 36/74 (48%), Positives = 45/74 (60%), Gaps = 5/74 (6%) Frame = -3 Query: 260 DRNEIGRSLSGRRTGKSPGRVMSDLHDRVRKPXXXXXXXXXXXRWPPTA-----TNHDES 96 +R+ +GRS S RRT +SPGRV + H+ V +WP T+ T +DES Sbjct: 246 NRSVMGRSPSTRRTNQSPGRVRKEAHEGVGN---GNMDNGMEAKWPSTSNVANGTTNDES 302 Query: 95 LENPLVSLECFIFL 54 LENPLVSLECFIFL Sbjct: 303 LENPLVSLECFIFL 316 >ref|XP_003593490.1| hypothetical protein MTR_2g012750 [Medicago truncatula] gi|355482538|gb|AES63741.1| hypothetical protein MTR_2g012750 [Medicago truncatula] Length = 265 Score = 55.5 bits (132), Expect = 5e-06 Identities = 32/68 (47%), Positives = 42/68 (61%) Frame = -3 Query: 257 RNEIGRSLSGRRTGKSPGRVMSDLHDRVRKPXXXXXXXXXXXRWPPTATNHDESLENPLV 78 R+ +GRSLS R+T +SPG+ + + + + WP TA +DESLENPLV Sbjct: 208 RSVVGRSLSARKTNQSPGKGRTAVPENGGRKMESK--------WPSTA--NDESLENPLV 257 Query: 77 SLECFIFL 54 SLECFIFL Sbjct: 258 SLECFIFL 265