BLASTX nr result
ID: Atractylodes21_contig00041343
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00041343 (253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADB85257.1| putative retrotransposon protein [Phyllostachys e... 49 5e-06 >gb|ADB85257.1| putative retrotransposon protein [Phyllostachys edulis] Length = 2039 Score = 48.5 bits (114), Expect(2) = 5e-06 Identities = 23/52 (44%), Positives = 30/52 (57%) Frame = -2 Query: 189 QRKYVLDILTKTRMLDSRVADSPMILKVKLHPYDIEHLQDPWRYRQL*GGKI 34 Q KY+ D+L + + D R ++PM L V L P D E L DP RYR L G + Sbjct: 1356 QEKYIQDLLDRASLTDQRTVETPMELNVHLRPSDGEPLSDPTRYRHLIGSLV 1407 Score = 26.6 bits (57), Expect(2) = 5e-06 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 253 GSLRCFQGIQVATSKKNNFLLSKE 182 G LRCF GI+V TS + F +S+E Sbjct: 1335 GPLRCFLGIEV-TSTPDGFFMSQE 1357