BLASTX nr result
ID: Atractylodes21_contig00041236
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00041236 (225 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI27664.3| unnamed protein product [Vitis vinifera] 84 1e-14 ref|XP_002271312.1| PREDICTED: squamosa promoter-binding-like pr... 84 1e-14 ref|XP_002304686.1| predicted protein [Populus trichocarpa] gi|2... 84 1e-14 emb|CAN77427.1| hypothetical protein VITISV_001736 [Vitis vinifera] 84 1e-14 gb|AGE09564.1| SPL2-like protein [Eucalyptus cladocalyx] 83 2e-14 >emb|CBI27664.3| unnamed protein product [Vitis vinifera] Length = 418 Score = 84.0 bits (206), Expect = 1e-14 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = -3 Query: 223 DLSSAKEYHRKHRVCESHSKCPKVVVGGLERRFCQQCSR 107 DLS+AK+YHRKHRVCESH+KCPKV+VGGLERRFCQQCSR Sbjct: 136 DLSTAKDYHRKHRVCESHTKCPKVIVGGLERRFCQQCSR 174 >ref|XP_002271312.1| PREDICTED: squamosa promoter-binding-like protein 12-like [Vitis vinifera] Length = 477 Score = 84.0 bits (206), Expect = 1e-14 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = -3 Query: 223 DLSSAKEYHRKHRVCESHSKCPKVVVGGLERRFCQQCSR 107 DLS+AK+YHRKHRVCESH+KCPKV+VGGLERRFCQQCSR Sbjct: 195 DLSTAKDYHRKHRVCESHTKCPKVIVGGLERRFCQQCSR 233 >ref|XP_002304686.1| predicted protein [Populus trichocarpa] gi|222842118|gb|EEE79665.1| predicted protein [Populus trichocarpa] Length = 233 Score = 84.0 bits (206), Expect = 1e-14 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 223 DLSSAKEYHRKHRVCESHSKCPKVVVGGLERRFCQQCSR 107 DLSSAK+YHRKHRVCESHSKCPKV+V GLERRFCQQCSR Sbjct: 195 DLSSAKDYHRKHRVCESHSKCPKVIVAGLERRFCQQCSR 233 >emb|CAN77427.1| hypothetical protein VITISV_001736 [Vitis vinifera] Length = 496 Score = 84.0 bits (206), Expect = 1e-14 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = -3 Query: 223 DLSSAKEYHRKHRVCESHSKCPKVVVGGLERRFCQQCSR 107 DLS+AK+YHRKHRVCESH+KCPKV+VGGLERRFCQQCSR Sbjct: 252 DLSTAKDYHRKHRVCESHTKCPKVIVGGLERRFCQQCSR 290 >gb|AGE09564.1| SPL2-like protein [Eucalyptus cladocalyx] Length = 488 Score = 83.2 bits (204), Expect = 2e-14 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -3 Query: 223 DLSSAKEYHRKHRVCESHSKCPKVVVGGLERRFCQQCSR 107 DLSSAK+YHRKHRVCESHSKCPKV+V G+ERRFCQQCSR Sbjct: 196 DLSSAKDYHRKHRVCESHSKCPKVIVSGIERRFCQQCSR 234