BLASTX nr result
ID: Atractylodes21_contig00041221
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00041221 (495 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN73046.1| hypothetical protein VITISV_008668 [Vitis vinifera] 72 4e-11 ref|XP_002265372.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-11 ref|XP_002329801.1| predicted protein [Populus trichocarpa] gi|2... 67 2e-09 gb|ABN08713.1| Pentatricopeptide repeat [Medicago truncatula] 64 1e-08 ref|XP_003543024.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 >emb|CAN73046.1| hypothetical protein VITISV_008668 [Vitis vinifera] Length = 477 Score = 72.4 bits (176), Expect = 4e-11 Identities = 28/58 (48%), Positives = 42/58 (72%) Frame = -1 Query: 495 ETYESLITLFCKKQDLYKAVHVFDEMVIDGCTPSEGTWGDLVCRVWGKQKAQGAADLM 322 +T++SL+ FC K DL+KA H+ DEMV+DGC P E TW +VC W ++K + +A+L+ Sbjct: 408 KTFDSLVNYFCNKGDLHKAAHLVDEMVLDGCIPDEXTWNAVVCAFWDRRKVRESAELV 465 >ref|XP_002265372.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46100 [Vitis vinifera] gi|296087974|emb|CBI35257.3| unnamed protein product [Vitis vinifera] Length = 503 Score = 71.6 bits (174), Expect = 6e-11 Identities = 28/58 (48%), Positives = 42/58 (72%) Frame = -1 Query: 495 ETYESLITLFCKKQDLYKAVHVFDEMVIDGCTPSEGTWGDLVCRVWGKQKAQGAADLM 322 +T++SL+ FC K DL+KA H+ DEMV+DGC P E TW +VC W ++K + +A+L+ Sbjct: 408 KTFDSLVNYFCNKGDLHKAAHLVDEMVLDGCIPDEVTWNAVVCAFWDRRKVRESAELV 465 >ref|XP_002329801.1| predicted protein [Populus trichocarpa] gi|222870863|gb|EEF07994.1| predicted protein [Populus trichocarpa] Length = 478 Score = 66.6 bits (161), Expect = 2e-09 Identities = 30/66 (45%), Positives = 42/66 (63%), Gaps = 5/66 (7%) Frame = -1 Query: 492 TYESLITLFCKKQDLYKAVHVFDEMVIDGCTPSEGTWGDLVCRVWGKQKAQGA-----AD 328 T++SL+ FCKK DL+KA +FDEMV+DGC P G W +V W ++K + A + Sbjct: 410 TFDSLVKCFCKKGDLHKAARIFDEMVLDGCVPDHGIWSAVVGGFWDRRKVREAFESIVVE 469 Query: 327 LMSELV 310 LM+E V Sbjct: 470 LMNEFV 475 >gb|ABN08713.1| Pentatricopeptide repeat [Medicago truncatula] Length = 479 Score = 63.9 bits (154), Expect = 1e-08 Identities = 23/57 (40%), Positives = 38/57 (66%) Frame = -1 Query: 492 TYESLITLFCKKQDLYKAVHVFDEMVIDGCTPSEGTWGDLVCRVWGKQKAQGAADLM 322 T++ L+ FCK+ DL KA + +EM++DGC P EG W L+C +W ++K + +L+ Sbjct: 410 TFDCLVKCFCKRGDLNKAARILEEMILDGCIPDEGMWNVLMCGLWDRKKVRETTELL 466 >ref|XP_003543024.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46100-like [Glycine max] Length = 479 Score = 61.6 bits (148), Expect = 6e-08 Identities = 25/62 (40%), Positives = 42/62 (67%), Gaps = 1/62 (1%) Frame = -1 Query: 495 ETYESLITLFCKKQDLYKAVHVFDEMVIDGCTPSEGTWGDLVCRVWGKQKAQGAAD-LMS 319 +T++ L+ FCK+ DL+KA + +EMV+DGC P EG W ++ +W ++K + A + L+ Sbjct: 409 DTFDCLVKCFCKRGDLHKAARILEEMVLDGCIPDEGVWNVVIGGLWDRKKVREATEQLLV 468 Query: 318 EL 313 EL Sbjct: 469 EL 470