BLASTX nr result
ID: Atractylodes21_contig00041164
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00041164 (258 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003571635.1| PREDICTED: sterol 3-beta-glucosyltransferase... 55 8e-06 >ref|XP_003571635.1| PREDICTED: sterol 3-beta-glucosyltransferase-like [Brachypodium distachyon] Length = 522 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/45 (60%), Positives = 30/45 (66%) Frame = +2 Query: 2 DPVTSHPVWHNRPSSPLLLYGFSKEVVESPGMVFSLDQNPLFWVL 136 DPVT+ P+WH R SPLLLYGFSKE+VE PG S FW L Sbjct: 223 DPVTNLPLWHVRAESPLLLYGFSKEIVERPGYWPSSAHVCGFWFL 267