BLASTX nr result
ID: Atractylodes21_contig00041101
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00041101 (270 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004149509.1| PREDICTED: puff-specific protein Bx42-like [... 62 6e-08 ref|XP_002530606.1| nuclear protein skip, putative [Ricinus comm... 62 6e-08 ref|XP_004139354.1| PREDICTED: SNW domain-containing protein 1-l... 60 2e-07 ref|XP_002332355.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 emb|CBI28015.3| unnamed protein product [Vitis vinifera] 59 5e-07 >ref|XP_004149509.1| PREDICTED: puff-specific protein Bx42-like [Cucumis sativus] gi|449523876|ref|XP_004168949.1| PREDICTED: puff-specific protein Bx42-like [Cucumis sativus] Length = 603 Score = 61.6 bits (148), Expect = 6e-08 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = +3 Query: 3 KVGSGGTMKASGGSSMREGYE-GSGRTRIGFERG 101 KVGSGGTM+A GGSSMR+GYE GSGRTRIGFERG Sbjct: 569 KVGSGGTMRAGGGSSMRDGYEGGSGRTRIGFERG 602 >ref|XP_002530606.1| nuclear protein skip, putative [Ricinus communis] gi|223529854|gb|EEF31786.1| nuclear protein skip, putative [Ricinus communis] Length = 238 Score = 61.6 bits (148), Expect = 6e-08 Identities = 30/35 (85%), Positives = 33/35 (94%), Gaps = 1/35 (2%) Frame = +3 Query: 3 KVGSGGTMKASGGSSMREGYE-GSGRTRIGFERGR 104 KVGSGGTM+ASGGSS R+GY+ GSGRTRIGFERGR Sbjct: 204 KVGSGGTMRASGGSSTRDGYDGGSGRTRIGFERGR 238 >ref|XP_004139354.1| PREDICTED: SNW domain-containing protein 1-like [Cucumis sativus] gi|449487951|ref|XP_004157882.1| PREDICTED: SNW domain-containing protein 1-like isoform 1 [Cucumis sativus] gi|449487953|ref|XP_004157883.1| PREDICTED: SNW domain-containing protein 1-like isoform 2 [Cucumis sativus] Length = 605 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/34 (85%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = +3 Query: 3 KVGSGGTMKASGGSSMREGYE-GSGRTRIGFERG 101 KVGSGGTM+ASGGSS R+GY+ GSGRTRIGFERG Sbjct: 571 KVGSGGTMRASGGSSTRDGYDGGSGRTRIGFERG 604 >ref|XP_002332355.1| predicted protein [Populus trichocarpa] gi|222832076|gb|EEE70553.1| predicted protein [Populus trichocarpa] Length = 596 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/35 (82%), Positives = 33/35 (94%), Gaps = 1/35 (2%) Frame = +3 Query: 3 KVGSGGTMKASGGSSMREGYE-GSGRTRIGFERGR 104 KVGSGGTM+ASGGSS R+G++ GSGRTRIGFERGR Sbjct: 562 KVGSGGTMRASGGSSTRDGHDGGSGRTRIGFERGR 596 >emb|CBI28015.3| unnamed protein product [Vitis vinifera] Length = 535 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 1/35 (2%) Frame = +3 Query: 3 KVGSGGTMKASGGSSMREGYE-GSGRTRIGFERGR 104 KVG+GGTM+AS GSSMR+G++ GSGRTRIGFERGR Sbjct: 501 KVGTGGTMRASAGSSMRDGHDGGSGRTRIGFERGR 535